DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and TPSD1

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:238 Identity:70/238 - (29%)
Similarity:104/238 - (43%) Gaps:40/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWW---CGGSI 66
            |.:|||.|.::.||.:....:.|.:..     |..|..|...|.|:.|.|...|.:|   ||||:
Human    11 LLLLALPVLASPAYVAPAPGQALQQTG-----IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL 70

  Fly    67 ISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHW-------------VGSGNFITHGSADIALI 118
            |..:|||||.||:..|...:   |..|...:..|.             |....:|....|||||:
Human    71 IHPQWVLTAAHCVEPDIKDL---AALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALL 132

  Fly   119 RIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS---PLPDYLQCVDLQIIHNSE 179
            .:.. |:....::.|.||..::.:......|..  |||.. |.:   |.|..|:.|::.::.|..
Human   133 ELEEPVNISSHIHTVTLPPASETFPPGMPCWVT--GWGDV-DNNVHLPPPYPLKEVEVPVVENHL 194

  Fly   180 CASYYGTG--------TVGDNIICVRVVDGKGTCGGDSGGPLV 214
            |.:.|.||        .|.|:::|.. .:...:|.||||||||
Human   195 CNAEYHTGLHTGHSFQIVRDDMLCAG-SENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 62/207 (30%)
Tryp_SPc 37..254 CDD:238113 62/206 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 62/206 (30%)
Tryp_SPc 38..240 CDD:214473 62/206 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.