DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and try-4

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:317 Identity:71/317 - (22%)
Similarity:111/317 - (35%) Gaps:93/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SASAYESVVHPKDLSKVAKI--EGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAE 76
            |..:::::|..:.|.:...|  |.:|.|        .|:.|.....|....||||||...::||.
 Worm    30 SMESFQTIVDNEVLMESCGIQQESKIKN--------FPWAVSFTVDGVNRLGGSIISPYHIITAA 86

  Fly    77 H----CIGG-------------------------DAVTVYFGATW-------------------- 92
            |    .||.                         |...|.:|.|.                    
 Worm    87 HGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVI 151

  Fly    93 --RTNAQFTHWVGSGNFITHG---SADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVA 151
              :..|...    .|.|.:..   ..|.|::.: ..:.|...|..:.||    |.|.|.......
 Worm   152 HNKVRAVLV----DGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLP----RPNMYYTKSLAV 208

  Fly   152 CGWGGTY---DGSPLPDYLQCVDLQIIHNSECASYYG--TGTVGDNIIC-----VRVVDGKGTCG 206
            .|||.:|   :..||   :..:.::|  :.:|...:.  .....|:.||     |.......||.
 Worm   209 PGWGRSYIFNESGPL---IHEIPMRI--DRDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCH 268

  Fly   207 GDSGGPLVTHDGSK----LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRDHTGIAY 259
            |||||.|...|.:.    |:.:|:: ...||.:...|.|.||..:|:.|.::||:.|
 Worm   269 GDSGGGLEYRDDNYGRAFLIAITSF-GTRGCPSNMLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 62/283 (22%)
Tryp_SPc 37..254 CDD:238113 63/285 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 64/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.