DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Tpsb2

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:288 Identity:90/288 - (31%)
Similarity:133/288 - (46%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWW---CG 63
            ::.|.:.||::.::..|.:   |:..::...|.|    |:.|.|.|.|:.|.|.|...:|   ||
Mouse     4 RLLLLLWALSLLASLVYSA---PRPANQRVGIVG----GHEASESKWPWQVSLRFKLNYWIHFCG 61

  Fly    64 GSIISNEWVLTAEHCIGGDAVT------------VYFGATWRTNAQFTHWVGSGNFITH------ 110
            ||:|..:|||||.||:|....:            :|:|         ...:.....:.|      
Mouse    62 GSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYG---------DQLLSLNRIVVHPHYYTA 117

  Fly   111 -GSADIAL--IRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDY-LQCV 170
             |.||:||  :.:| |:....::.:.||..::.:......|..  |||...:..|| |.| |:.|
Mouse   118 EGGADVALLELEVP-VNVSTHLHPISLPPASETFPPGTSCWVT--GWGDIDNDEPLPPPYPLKQV 179

  Fly   171 DLQIIHNSECASYYGTGT-VGDNIICVRVVDG--------KGTCGGDSGGPLVTH-DGSKL-VGV 224
            .:.|:.||.|...|.||. .||:...|.  ||        :.:|.||||||||.. .|:.| .||
Mouse   180 KVPIVENSLCDRKYHTGLYTGDDFPIVH--DGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGV 242

  Fly   225 TNWVSGAGC-QAGHPAGFQRVTYHLDWI 251
            .:|  |.|| |...|..:.||||:||||
Mouse   243 VSW--GEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 81/252 (32%)
Tryp_SPc 37..254 CDD:238113 83/253 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.