DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG43336

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:257 Identity:66/257 - (25%)
Similarity:99/257 - (38%) Gaps:63/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIISNEWVLTAEHC-IGGDAVTVYFGATWRTNAQF 98
            |:.||..|....:|:...| ...|.:.||||:|:|..||||.|| :....:....|...|...:.
  Fly    37 RVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEM 101

  Fly    99 THWVGSGNFITHG-------------------SADIALIRIPHVDFWHMVNKVELPSYND----- 139
            .|    .::.|:.                   :.|||::|        :..||:   |.|     
  Fly   102 CH----DSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILR--------LYRKVQ---YTDNIRPI 151

  Fly   140 ------RYNDYNEWW--AVACGWGGT-YDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIIC 195
                  |:..|.:..  ....|||.| .:|....  |:.|||...|...|.. |.|.::..|..|
  Fly   152 CIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAK--LRTVDLARKHPEVCRR-YATLSLTANQFC 213

  Fly   196 VRVVDGKGTCGGDSGGP---LVTHDGSK---LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251
            .. .:....|.||||||   |:.:..||   .||:.::.:   .|....:.|..|..::|||
  Fly   214 AG-NERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTN---TQCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 64/255 (25%)
Tryp_SPc 37..254 CDD:238113 65/256 (25%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 64/255 (25%)
Tryp_SPc 40..271 CDD:238113 63/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.