DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and CG43125

DIOPT Version :10

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:34 Identity:13/34 - (38%)
Similarity:19/34 - (55%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 APYTVGL--GFSGGWWCGGSIISNEWVLTAEHCI 79
            ||:.|.:  ..|....|.|::|:..:||||..||
  Fly    36 APWLVKIRPELSSNITCTGTLINERFVLTAASCI 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 13/34 (38%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 12/33 (36%)

Return to query results.
Submit another query.