DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Cela1

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:289 Identity:80/289 - (27%)
Similarity:117/289 - (40%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFS-GGWW---CGG 64
            ||...:|.:...|..:          |.:.:.|:..|..|.....|..:.|.:. ||.|   |||
Mouse     4 FLVFASLVLCGHSTED----------VPETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGG 58

  Fly    65 SIISNEWVLTAEHCIGGDAVTVY------------FGATWRTNAQ--FTHWVGSGNFITHGSADI 115
            ::|.:.||:||.||:  |:...|            .|.....|.|  .:|...:.|.:..| .||
Mouse    59 TLIRSNWVMTAAHCV--DSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAG-YDI 120

  Fly   116 ALIRIPHVDFWHMVNKVELPSYNDRYNDY--------------NEWWAVACGWGGTYDGSPLPDY 166
            ||:|        :...|.|       |:|              |.......|||.|.....|...
Mouse   121 ALLR--------LAKSVTL-------NNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQT 170

  Fly   167 LQCVDLQIIHNSEC--ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTH---DGSKLV-GVT 225
            ||...|..:..|.|  :||:|: :|.:.::|......:..|.|||||||  |   :|...| |||
Mouse   171 LQQAYLPSVSYSICSSSSYWGS-SVKNTMVCAGGDGVRSGCQGDSGGPL--HCMVNGQYAVHGVT 232

  Fly   226 NWVSGAGCQ-AGHPAGFQRVTYHLDWIRD 253
            ::||..||. |..|..|.||:.::.|:.:
Mouse   233 SFVSSMGCNVARKPTVFTRVSAYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 74/253 (29%)
Tryp_SPc 37..254 CDD:238113 74/256 (29%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 74/252 (29%)
Tryp_SPc 27..262 CDD:238113 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.