DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and Ctrl

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:236 Identity:77/236 - (32%)
Similarity:110/236 - (46%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAEEGKAPYTVGLGFSGGW-WCGGSIISNEWVLTAEHCIGGDAVT-----VYFGATWR- 93
            ||.||..|..|..|:.|.|..:.|: :||||:||..||:||.||    .||     |..|...| 
Mouse    33 RIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLISPNWVVTAAHC----QVTPGRHFVVLGEYDRS 93

  Fly    94 TNAQFTHWVGSGNFITHG-------SADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAV 150
            :||:....:.....|||.       :.|:.|:::.. ..:...|:.|.|.|.|:...  :....|
Mouse    94 SNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCLASTNEALP--SGLTCV 156

  Fly   151 ACGWG---GTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGP 212
            ..|||   |.  |:..|..||.|.|.::..::|..|:| ..:.|.:||.. ..|..:|.||||||
Mouse   157 TTGWGRISGV--GNVTPARLQQVVLPLVTVNQCRQYWG-ARITDAMICAG-GSGASSCQGDSGGP 217

  Fly   213 LVTHDGSK--LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251
            ||...|:.  |:|:.:| ....|....||.:.||:....||
Mouse   218 LVCQKGNTWVLIGIVSW-GTKNCNIQAPAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 75/234 (32%)
Tryp_SPc 37..254 CDD:238113 76/235 (32%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 75/234 (32%)
Tryp_SPc 34..260 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.