DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and zgc:163079

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:274 Identity:77/274 - (28%)
Similarity:124/274 - (45%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPY--TVGLGFSGGWWCGGSI 66
            |.::..:|.|........:...|:...|.:..:|..|..|.:|..|:  ::.|..:..::||||:
Zfish     3 FNSVFCVAGAILLNIAGCLGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSL 67

  Fly    67 ISNEWVLTAEHCIG---GDAVTVYFGA-------TWRTNAQFTHWVGSGNFITHGSADIALIRIP 121
            |:..||||......   ...:.||.|.       .:..:...|..:...|:.:..| ::||:::.
Zfish    68 INKGWVLTTAKVFALMPASDIVVYLGRQTQNGSNPYEISRTVTKIIKHPNYNSLDS-NLALLKLS 131

  Fly   122 H-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG-----GTYDGSPLPDYLQCVDLQIIHNSEC 180
            . |.|...:..|.|.:....:.|....|..  |||     .|.:...|||.||.|:..|::|.||
Zfish   132 SPVTFSDYIKPVCLAAAGSVFVDGTASWVT--GWGYLNRPATVEEIMLPDVLQEVEAPIVNNFEC 194

  Fly   181 ASYYGTGTVGDNIICVRVV--DGKGTCGGDSGGPLVTHDGSKLV--GVTNWVSGAGCQAGHPAGF 241
            .:.|| |.:.:.::|...:  |||..|.||.|||||...|:..:  ||.  |||.....|:|..:
Zfish   195 NAAYG-GIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVV--VSGYCGLPGYPTIY 256

  Fly   242 QRVTYHLDWIRDHT 255
            .||:.:.|||..:|
Zfish   257 VRVSEYEDWISYYT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 69/236 (29%)
Tryp_SPc 37..254 CDD:238113 71/238 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 69/236 (29%)
Tryp_SPc 36..267 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.