DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Ci and LOC100004427

DIOPT Version :9

Sequence 1:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:268 Identity:84/268 - (31%)
Similarity:125/268 - (46%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF--SGGWWCGGS 65
            :|.|:..:|.|........:...|:...|.:..:|..|..|.||..|:...:.|  :|.::|.||
Zfish     2 MFNTVFCVAGAVLLNIAGCLGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFKSTGQFFCSGS 66

  Fly    66 IISNEWVLTAEHC---IGGDAVTVYFGATWRTNAQFTHWVGSGNFITHGSADIALIRI-PHVDFW 126
            :||..|||||..|   |....|.:|.|.. .||....:.:.........:.||||::: ..|.|.
Zfish    67 LISERWVLTAASCFQRINVSDVVIYLGRL-TTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFT 130

  Fly   127 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP-LPDYLQCVDLQIIHNSECASYYGTGTVG 190
            ..:..|.|.:....:.|..|.|..  |||.|...:. |.|.|:.|:..|::|.||::..|...: 
Zfish   131 DYIRPVCLAAAGSVFVDGTESWVT--GWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNL- 192

  Fly   191 DNIICVRVVD--GKGTCGGDSGGPLVTHDGSKLVGVTNWV-SG----AGC-QAGHPAGFQRVTYH 247
            ||:||...|:  ||..|..|.|.||||..||:      |: ||    ..| |.|.|..:.||:.:
Zfish   193 DNVICAGFVNETGKAPCWEDFGSPLVTRQGSQ------WIQSGVVVFTFCGQNGFPTLYARVSEY 251

  Fly   248 LDWIRDHT 255
            .:|||::|
Zfish   252 EEWIRNYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 74/229 (32%)
Tryp_SPc 37..254 CDD:238113 77/231 (33%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 74/229 (32%)
Tryp_SPc 36..257 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.