DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and DGCR2

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_005128.1 Gene:DGCR2 / 9993 HGNCID:2845 Length:550 Species:Homo sapiens


Alignment Length:202 Identity:45/202 - (22%)
Similarity:67/202 - (33%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 NCYIGSEFLCGNNH-CISIRLHC--DGFDHCGDGSD----------EPDSCEEDWAHLHHDRRWY 488
            :||..|.|||..:. |:.|:.:.  :||.....|.|          ||:.|...........:.|
Human   256 SCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQGCQQY 320

  Fly   489 SHKPN--YYFPKIDQYPDLKT-----ATGI-FIISTLGIFGVLSGWMVILYRMGVRAR------- 538
            ...|.  ..|..:|  ||..:     |:|: .::|.:..|.:||..:.:::|:..|.|       
Human   321 RKDPKECCKFMCLD--PDGNSLFDSMASGMRLVVSCISSFLILSLLLFMVHRLRQRRRERIESLI 383

  Fly   539 ----HQRELQSHLQTISELLDRQDEDRTP---------------DEPPSYEA------------P 572
                |...|...:.......|......||               |.||.|.|            |
Human   384 GANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEGGTFHFHDPPPPYTAYKYPDIGQPDDPP 448

  Fly   573 PDYEEVI 579
            |.||..|
Human   449 PPYEASI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 11/42 (26%)
DGCR2NP_005128.1 LDLa 30..66 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..92
CLECT_DGCR2_like 115..267 CDD:153069 6/10 (60%)
VWC 271..329 CDD:214564 11/57 (19%)
Atrophin-1 <428..537 CDD:331285 10/28 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.