Sequence 1: | NP_729364.1 | Gene: | Culd / 38946 | FlyBaseID: | FBgn0035880 | Length: | 965 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124079.1 | Gene: | ldlrad3 / 570705 | ZFINID: | ZDB-GENE-030131-1533 | Length: | 314 | Species: | Danio rerio |
Alignment Length: | 279 | Identity: | 65/279 - (23%) |
---|---|---|---|
Similarity: | 87/279 - (31%) | Gaps: | 113/279 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 417 RGVFGMSSKLAIVYSVFNYLNCYIGSEFLCGNN-HCISIRLHCDGFDHCGDGSDEPDSCEEDWAH 480
Fly 481 --LHHDRRWY-------------------------------SHKPNYYFPKID----QYPDLKTA 508
Fly 509 T-GIFIISTLGIFGVLSGWMVILYRMGVR-----------ARHQRELQSHLQTI--SELLDRQDE 559
Fly 560 DRTP----DEPPSY------------------------EAPPDYEEVIKVGMQQELREPRRQ--- 593
Fly 594 RRARRAPPRDRSCSRAASN 612 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Culd | NP_729364.1 | CUB | 200..298 | CDD:238001 | |
LDLa | 442..472 | CDD:238060 | 16/30 (53%) | ||
ldlrad3 | NP_001124079.1 | LDLa | 30..62 | CDD:238060 | 1/1 (100%) |
LDLa | 69..104 | CDD:238060 | 18/48 (38%) | ||
LDLa | 111..145 | CDD:238060 | 1/33 (3%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |