DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and lrp1bb

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_021334671.1 Gene:lrp1bb / 559293 ZFINID:ZDB-GENE-070912-401 Length:4600 Species:Danio rerio


Alignment Length:646 Identity:125/646 - (19%)
Similarity:205/646 - (31%) Gaps:218/646 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TCAECVIRVAFTYANFSKSCGNTGGKSSMCPC---EHIQFSEPPYDSTISGQE------------ 142
            ||.:  |....|....|::|.||.| |..|.|   ......:|....::|.:|            
Zfish  2933 TCVD--IDECSTTLPCSQNCTNTYG-SYKCLCVDGYEASRKDPNSCKSLSAEEPFLILADLHEIR 2994

  Fly   143 -FCGDGKVF----RSKTRTLQLKFFYRASNAHVFSLQYFSERNVRIVSGSPKQSIVGNGSTKSQP 202
             ...||..:    :.....:.|.|.|:..    |.....|.|    .||.....|..||   |..
Zfish  2995 KLSVDGSNYTLLKQGLNNIISLDFDYKKE----FIYWIDSSR----PSGRRINRIRLNG---SDL 3048

  Fly   203 QVISTPYFPMAYPRDYGIEHILTCEADNCQVRLDFTDFQLGLTSTLEIFDSNGQMLDSYTGEHFR 267
            :::.....|.|...|:..:::..|:.:.               .|||:..|||          ..
Zfish  3049 KIVHRTAVPSALAVDWIGKNLYWCDVER---------------KTLEVSKSNG----------LY 3088

  Fly   268 PPITVSSGKSLLLQFRGNSATGVGFRAEVSFVSSKQLKDERLVPYTDCG--------GMVTGPGG 324
            |.|.||||.        .:.|.:...|:..:|.           :.||.        || .|.|.
Zfish  3089 PTILVSSGL--------KNPTDLALDAQTGYVF-----------WIDCCENPHVGRIGM-DGQGQ 3133

  Fly   325 AITMMNMIENA-------TDVRLFDCIWIIKPGNNYMMMKT------------HI------SLRV 364
            ::.:...|.:.       |:.|::   |   ..:|:::...            ||      :|..
Zfish  3134 SVIVNKEIYSPSALTIDYTNKRIY---W---ADDNHILFANMDGSQRHRVPHDHIQGVMGLTLFE 3192

  Fly   365 DDFYGMAARSELTIRQG---TTSDAVEIEN---------VMWPNNGLSKESHVAPILNG------ 411
            |..|....:|: ::|:.   |.::|||:.|         |..|........|...:.||      
Zfish  3193 DFIYWTDGKSK-SLRRAHKTTGANAVELLNSWQAIKSVIVYHPLRQPEVPKHQCQVANGGCSHLC 3256

  Fly   412 ---------------YYIRLRGVFGMSSKLAIVYSVFNYLNCYIGSEFLCGNNHCISIRLHCDGF 461
                           :|:.......:|             || ..|:|.||.:.||.....||..
Zfish  3257 LLSPGGGHKCACPTNFYLAADNKTCLS-------------NC-TASQFRCGTDECIPFWWKCDTV 3307

  Fly   462 DHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYFPKIDQYPDLKTATGI-----FII------- 514
            |.||||||||..|.|           :..:|..:          :..||:     ||.       
Zfish  3308 DDCGDGSDEPADCPE-----------FKCQPGRF----------QCGTGLCALPPFICDGENDCG 3351

  Fly   515 -----STLGIFGVLSGWMVILYRMGVRARHQRELQSHLQT--ISELLDRQDEDRTPD---EPPSY 569
                 :....:..|||....       :|.|:.:..:|:.  ..:..|.:||...|:   .|..:
Zfish  3352 DNSDEANCDTYICLSGQFKC-------SRKQKCIPLNLRCNGQDDCGDGEDETDCPESTCSPDQF 3409

  Fly   570 EAPPDYEEVIKVGMQQELREPRRQRRARRAPPRDRSCSRAASNCTVQSVLPLHRSCTLERD 630
            :.......:.|:.:..|  :|.....:..|...:::|......|...:.:|.|..|..:.|
Zfish  3410 QCKASMHCISKLWVCDE--DPDCADGSDEANCDEKTCGPHEFRCENNNCIPDHWRCDSQND 3468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001 19/97 (20%)
LDLa 442..472 CDD:238060 16/29 (55%)
lrp1bbXP_021334671.1 LDLa 38..76 CDD:294076
FXa_inhibition 128..156 CDD:317114
LY 238..274 CDD:214531
LY 282..324 CDD:214531
LY 326..367 CDD:214531
FXa_inhibition 452..484 CDD:317114
LY 516..558 CDD:214531
LY 559..598 CDD:214531
LY 605..654 CDD:214531
LY 655..697 CDD:214531
FXa_inhibition 766..801 CDD:317114
LDLa 854..887 CDD:238060
LDLa 895..926 CDD:197566
LDLa 939..970 CDD:238060
LDLa 974..1005 CDD:197566
LDLa 1021..1056 CDD:238060
LDLa 1065..1099 CDD:238060
FXa_inhibition 1144..1180 CDD:317114
FXa_inhibition 1192..1220 CDD:317114
LY 1248..1289 CDD:214531
LY 1295..1337 CDD:214531
LY 1339..1382 CDD:214531
LY <1394..1427 CDD:214531
Ldl_recept_b 1586..1625 CDD:278487
LY 1609..1651 CDD:214531
LY 1653..1693 CDD:214531
LY <1703..1734 CDD:214531
FXa_inhibition 1806..1842 CDD:317114
NHL <1858..1941 CDD:302697
NHL repeat 1879..1916 CDD:271320
LY 1915..1955 CDD:214531
Ldl_recept_b 1976..2016 CDD:278487
LY 2001..2041 CDD:214531
FXa_inhibition 2115..2150 CDD:317114
Ldl_recept_b 2298..2339 CDD:278487
LY 2323..2365 CDD:214531
FXa_inhibition 2436..2470 CDD:317114
LDLa 2482..2511 CDD:238060
LDLa 2520..2554 CDD:238060
LDLa 2559..2593 CDD:238060
LDLa <2613..2642 CDD:294076
LDLa 2650..2684 CDD:238060
LDLa 2688..2719 CDD:238060
LDLa 2728..2761 CDD:197566
LDLa 2772..2804 CDD:197566
LDLa 2813..2846 CDD:238060
LDLa 2859..2893 CDD:238060
cEGF 2916..2939 CDD:315355 3/7 (43%)
EGF_CA 2936..2969 CDD:214542 10/35 (29%)
LY 3003..3047 CDD:214531 11/54 (20%)
LY 3050..3086 CDD:214531 8/50 (16%)
LY 3135..3174 CDD:214531 5/44 (11%)
FXa_inhibition 3245..3281 CDD:317114 3/35 (9%)
LDLa 3285..3316 CDD:197566 15/31 (48%)
LDLa 3325..3359 CDD:238060 5/43 (12%)
LDLa 3364..3399 CDD:238060 9/41 (22%)
LDLa 3404..3439 CDD:238060 5/36 (14%)
LDLa 3444..3478 CDD:238060 6/25 (24%)
LDLa 3483..3517 CDD:238060
LDLa 3521..3555 CDD:238060
LDLa 3563..3597 CDD:238060
LDLa 3601..3636 CDD:238060
LDLa 3643..3675 CDD:238060
LDLa 3730..3765 CDD:238060
Ldl_recept_b 4008..4048 CDD:278487
LY 4032..4073 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.