DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and lrp8

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_005166314.1 Gene:lrp8 / 557734 ZFINID:ZDB-GENE-050506-134 Length:1008 Species:Danio rerio


Alignment Length:245 Identity:48/245 - (19%)
Similarity:71/245 - (28%) Gaps:90/245 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 SEFLCGNNHCISIRLHCDGFDHCGDGSDEPDS-CEEDWAHLHHDRRWYSHKPNYYFPKIDQYPDL 505
            ::|.|.|..|:..|..|||...|.|||||.|| |.....                       |..
Zfish    70 TDFACKNGQCVPGRWRCDGEPECPDGSDEADSACSRQTC-----------------------PPE 111

  Fly   506 KTATGIFIISTLGIFGVLSGWMVILYR-----------------MGVRARHQRELQSHLQTI--- 550
            |...|          |..|..:.:.:|                 ...:|...:|.|...:..   
Zfish   112 KFDCG----------GSTSKCVSLSWRCDGERDCENGADEEQCAADAKACPAKEFQCRNRMCVAP 166

  Fly   551 -------SELLDRQDEDRT---------PDE-----------PPSYEAPPDYEEVIKVGMQQELR 588
                   .:..||.||::.         |.|           |.|.:..||.         ::..
Zfish   167 TFVCDGDDDCGDRSDEEKCTAATASTCGPHEFRCNDSECIPTPWSCDGDPDC---------RDKS 222

  Fly   589 EPRRQRRARRAPPRDRSCSRAASNCTVQSVLPLHRSCTLERDQEQPSTSA 638
            :...:|.:||..|:...||.....|.....:.|:..|..:.|.:..|..|
Zfish   223 DESLERCSRRTEPQKPHCSMGEFRCRSGECIHLNWKCDGDPDCKDKSDEA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 14/29 (48%)
lrp8XP_005166314.1 LDLa 66..98 CDD:197566 12/27 (44%)
Ldl_recept_a 107..144 CDD:278486 6/69 (9%)
Ldl_recept_a 191..224 CDD:278486 6/41 (15%)
Ldl_recept_a 240..274 CDD:278486 8/33 (24%)
Ldl_recept_a 278..313 CDD:278486
LDLa 322..352 CDD:197566
FXa_inhibition 362..396 CDD:291342
EGF_CA 398..428 CDD:214542
LY 463..504 CDD:214531
LY 511..552 CDD:214531
Ldl_recept_b 573..613 CDD:278487
LY 597..639 CDD:214531
Ldl_recept_b 660..699 CDD:278487
FXa_inhibition 718..755 CDD:291342
IgaA 913..>985 CDD:284503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.