powered by:
Protein Alignment Culd and Cd320
DIOPT Version :9
Sequence 1: | NP_729364.1 |
Gene: | Culd / 38946 |
FlyBaseID: | FBgn0035880 |
Length: | 965 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062294.3 |
Gene: | Cd320 / 54219 |
MGIID: | 1860083 |
Length: | 260 |
Species: | Mus musculus |
Alignment Length: | 39 |
Identity: | 15/39 - (38%) |
Similarity: | 21/39 - (53%) |
Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 444 FLC-GNNHCISIRLHCDGFDHCGDGSDEPD----SCEED 477
|.| .:.:|:.:...|||...|.|||||.| ||.::
Mouse 52 FQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQN 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.