Sequence 1: | NP_729364.1 | Gene: | Culd / 38946 | FlyBaseID: | FBgn0035880 | Length: | 965 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061027.2 | Gene: | LRP1B / 53353 | HGNCID: | 6693 | Length: | 4599 | Species: | Homo sapiens |
Alignment Length: | 257 | Identity: | 52/257 - (20%) |
---|---|---|---|
Similarity: | 71/257 - (27%) | Gaps: | 119/257 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 346 IIKPGNNYMMMKTHISLRVDDFYGMAARSELTIRQGTTSDAVEIENVMWPNNGLSKESHVAPI-- 408
Fly 409 LNGYYIRLRGVFGMSSKLAIVYS----------------VF--NYLN------------------ 437
Fly 438 ---------------------CYIGS--------------------------------------- 442
Fly 443 -------EFLCGNNHCISIRLHCDGFDHCGDGSDEPD------SCEEDWAHLHHDR----RW 487 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |