DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and CD320

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_057663.1 Gene:CD320 / 51293 HGNCID:16692 Length:282 Species:Homo sapiens


Alignment Length:159 Identity:42/159 - (26%)
Similarity:56/159 - (35%) Gaps:45/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 QQELR-EPRRQRRARRAPP------------------RDRSCSRAAS-----NCTV-QSVLPLHR 623
            ::|.| ||..|:.....||                  :.|:|||.|.     .||: ...:||..
Human    86 EEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTW 150

  Fly   624 SCTLERDQEQPSTSAAAMTHAVAAT-DTTEDAEHVQTMAQRMLLATAICGTAGTSLPAAKESG-- 685
            .|....|....|......|:.:... |.|       ||...:.|.:.      |||..|...|  
Human   151 RCDGHPDCPDSSDELGCGTNEILPEGDAT-------TMGPPVTLESV------TSLRNATTMGPP 202

  Fly   686 ---QRVQSVGISTSPSSLSAGGELPTAGG 711
               :.|.|||.:||.|:....|. |||.|
Human   203 VTLESVPSVGNATSSSAGDQSGS-PTAYG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060
CD320NP_057663.1 LDLa 54..89 CDD:238060 0/2 (0%)
LDLa 132..167 CDD:238060 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.