DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and Lrp3

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001019878.1 Gene:Lrp3 / 435965 MGIID:3584516 Length:790 Species:Mus musculus


Alignment Length:195 Identity:52/195 - (26%)
Similarity:72/195 - (36%) Gaps:66/195 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 NYLNCYIGSEFLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYFPK 498
            |..:|..|: |.||.|.||.....|||.:.|.|||||                   |......|:
Mouse   471 NCFSCQPGT-FHCGTNLCIFETWRCDGQEDCQDGSDE-------------------HGCLAAVPR 515

  Fly   499 IDQYPDLKTATGIFIISTL-GIFGVLS-GWMVILYRMGVRARHQRELQSHLQTI-SELLDRQDED 560
                   |..|...|.|.: |:..|:: |....||  .:|.:..|..::.:..: :|.:.|    
Mouse   516 -------KVITAALIGSLVCGLLLVIALGCAFKLY--SLRTQEYRAFETQMTRLEAEFVRR---- 567

  Fly   561 RTPDEPPSYEAPPDYEEVIKVGM-----------------QQELREP-RRQRR---ARRAPPRDR 604
                     ||||.|.::|..|:                 .|.||.. |||.|   :||.|.|.|
Mouse   568 ---------EAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRR 623

  Fly   605  604
            Mouse   624  623

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 15/29 (52%)
Lrp3NP_001019878.1 CUB 64..177 CDD:238001
LDLa 187..221 CDD:238060
LDLa 233..270 CDD:238060
CUB 275..385 CDD:238001