DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and LRP5

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_011543331.1 Gene:LRP5 / 4041 HGNCID:6697 Length:1662 Species:Homo sapiens


Alignment Length:137 Identity:34/137 - (24%)
Similarity:46/137 - (33%) Gaps:41/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 SEFLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKPNYYFPKIDQYPDLK 506
            ::|.|.:..|:.|:..||.|..|.|||||. .||                  ...|..|..|...
Human  1348 NQFRCASGQCVLIKQQCDSFPDCIDGSDEL-MCE------------------ITKPPSDDSPAHS 1393

  Fly   507 TATGIFIISTLGIFGVLSGWMVILYRM------GVRARHQRELQSHLQTISELLDRQDEDRTPDE 565
            :|.|..|...|.:| |:.|...:..|:      |.......|..|               .||..
Human  1394 SAIGPVIGIILSLF-VMGGVYFVCQRVVCQRYAGANGPFPHEYVS---------------GTPHV 1442

  Fly   566 PPSYEAP 572
            |.::.||
Human  1443 PLNFIAP 1449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 13/29 (45%)
LRP5XP_011543331.1 NHL <46..>178 CDD:302697
NHL repeat 74..113 CDD:271320
LY 111..151 CDD:214531
NHL repeat 116..157 CDD:271320
Ldl_recept_b 172..212 CDD:278487
LY 196..238 CDD:214531
FXa_inhibition 308..345 CDD:291342
LY 375..415 CDD:214531
LY 417..459 CDD:214531
LY 460..503 CDD:214531
LY 504..546 CDD:214531
LY 547..580 CDD:214531
FXa_inhibition 614..649 CDD:291342
NHL 694..887 CDD:302697
LY 719..761 CDD:214531
NHL repeat 729..765 CDD:271320
NHL repeat 772..811 CDD:271320
NHL repeat 856..880 CDD:271320
FXa_inhibition 915..950 CDD:291342
LY 979..1018 CDD:214531
LY 1069..1112 CDD:214531
LY 1113..1155 CDD:214531
FXa_inhibition 1226..1262 CDD:291342
Ldl_recept_a 1267..1304 CDD:278486
LDLa 1307..1341 CDD:238060
LDLa 1345..1379 CDD:238060 13/31 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.