DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and LRP3

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_005259002.1 Gene:LRP3 / 4037 HGNCID:6695 Length:785 Species:Homo sapiens


Alignment Length:571 Identity:126/571 - (22%)
Similarity:178/571 - (31%) Gaps:143/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 DNCQVRLDFTDFQLGLTSTLEIFDSNGQMLD------SYTGEHFRPPITVSSGK-SLLLQFRGNS 286
            |:.:|.|.. :.:||....:::::..|:..|      ||...|....:..:.|: ::....|..|
Human   290 DSRRVLLQL-ELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARS 353

  Fly   287 ATGVGFRAEVSFVSSKQLKDERLVPYTDCGGMVTGPGGAITMMNMIENATDVRLFDCIWIIKPGN 351
            | |.||.|      :.|:|...|.....||......||::......   ::.:..|..|....|.
Human   354 A-GHGFNA------TYQVKGYCLPWEQPCGSSSDSDGGSLGDQGCF---SEPQRCDGWWHCASGR 408

  Fly   352 NYMMMKTHISLRVDDFYGMAARSELTIRQGTTSDAVEIENVMWPNNGLSKESHVAPILNGYYIRL 416
            :    :........|.|.....|.|..   |.:|..        ||..|...             
Human   409 D----EQGCPACPPDQYPCEGGSGLCY---TPADRC--------NNQKSCPD------------- 445

  Fly   417 RGVFGMSSKLAIVYSVFNYLNCYIGSEFLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHL 481
                |...|        |..:|..|: |.||.|.||.....|||.:.|.|||||           
Human   446 ----GADEK--------NCFSCQPGT-FHCGTNLCIFETWRCDGQEDCQDGSDE----------- 486

  Fly   482 HHDRRWYSHKPNYYFPKIDQYPDLKTATGIFIISTL-GIFGVLS-GWMVILYRMGVRARHQRELQ 544
                    |......|:       |..|...|.|.: |:..|:: |....||.:..:....|..|
Human   487 --------HGCLAAVPR-------KVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRSRAAQ 536

  Fly   545 S--HLQTISELLDRQDEDRTPDEPPSYEAPPDYEEVIKVGM-----------------QQELREP 590
            |  ...|.|...:.| ..|...|....||||.|.::|..|:                 .|.||..
Human   537 SCRPPPTASRAFETQ-MTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTA 600

  Fly   591 -RRQRR---ARRAPPRDRSCSRAASNCTVQSVLPLHRSCTLERDQEQPSTSAAAMTHAVAATDTT 651
             |||.|   :||.|.| |...|..:..       .||. ...|.| .|..:||..:..|......
Human   601 MRRQMRRHASRRGPSR-RRLGRLWNRL-------FHRP-RAPRGQ-IPLLTAARPSQTVLGDGFL 655

  Fly   652 EDAEHVQTMAQRMLLATAICGTAGTSLPAAKESGQRVQSVGISTSPSSLSAGGELPTAGGSATTP 716
            :.|..........|:.|.....||...|:|.   .|...||.|..|        ||:        
Human   656 QPAPGAAPDPPAPLMDTGSTRAAGDRPPSAP---GRAPEVGPSGPP--------LPS-------- 701

  Fly   717 GSTADECTQGGDSLSISLTLGLPSTTAESPVTTDQNQLQKQSPEQTISNCT 767
            |....||........:...   |.....:|....:.....|.|...:|..:
Human   702 GLRDPECRPVDKDRKVCRE---PLVDGPAPADAPREPCSAQDPHPQVSTAS 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001 18/75 (24%)
LDLa 442..472 CDD:238060 15/29 (52%)
LRP3XP_005259002.1 CUB 43..156 CDD:238001
LDLa 166..200 CDD:238060
LDLa 212..249 CDD:238060
CUB 254..364 CDD:238001 18/81 (22%)
LDLa 416..452 CDD:238060 11/71 (15%)
LDLa 455..489 CDD:238060 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.