Protein Alignment Culd and LDLR

DIOPT Version :9

• Sequence 1: NP_729364.1
• Gene: Culd / 38946
• FlyBaseID: FBgn0035880
• Length: 965
• Species: Drosophila melanogaster
• Sequence 2: NP_000518.1
• Gene: LDLR / 3949
• HGNCID: 6547
• Length: 860
• Species: Homo sapiens
• Alignment Length: 34
• Identity: 16/34 - (47%)
• Similarity: 21/34 - (61%)
• Gaps: 1/34 - (2%)

  Fly   442 SEFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474
            :||.|.:..|||.:..|||...|.||||| .::|
Human    30 NEFQCQDGKCISYKWVCDGSAECQDGSDESQETC 63

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Culd	NP_729364.1	CUB	200..298	CDD:238001
		LDLa	442..472	CDD:238060	15/30 (50%)
LDLR	NP_000518.1	Ldl_recept_a	25..58	CDD:278486	13/27 (48%)
		Ldl_recept_a	66..104	CDD:278486
		Ldl_recept_a	107..143	CDD:278486
		Ldl_recept_a	147..179	CDD:278486
		Ldl_recept_a	195..231	CDD:278486
		Ldl_recept_a	235..270	CDD:278486
		LDLa	278..308	CDD:294076
		FXa_inhibition	318..>346	CDD:291342
		EGF_CA	354..388	CDD:214542
		LDL-receptor class B 1	397..438
		LY	419..457	CDD:214531
		LDL-receptor class B 2	439..485
		Ldl_recept_b	439..482	CDD:278487
		LDL-receptor class B 3	486..528
		Ldl_recept_b	487..525	CDD:278487
		LDL-receptor class B 4	529..572
		Ldl_recept_b	529..569	CDD:278487
		LY	553..595	CDD:214531
		LDL-receptor class B 5	573..615
		LDL-receptor class B 6	616..658
		Ldl_recept_b	616..655	CDD:278487
		FXa_inhibition	671..711	CDD:291342
		Clustered O-linked oligosaccharides	721..768
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	734..755
		Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913	811..860
		NPXY motif. /evidence=ECO:0000269|PubMed:22509010	823..828

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900