DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Culd and vldlr

DIOPT Version :9

Sequence 1:	NP_729364.1	Gene:	Culd / 38946	FlyBaseID:	FBgn0035880	Length:	965	Species:	Drosophila melanogaster
Sequence 2:	XP_005155618.1	Gene:	vldlr / 393897	ZFINID:	ZDB-GENE-040426-803	Length:	877	Species:	Danio rerio

Alignment Length:	49	Identity:	21/49 - (42%)
Similarity:	27/49 - (55%)	Gaps:	12/49 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   436 LNCYIGS------EFLCGNNHCISIRLHCDGFDHCGDGSDE----PDSC 474
            :||  |:      ||.|.:..|:|.:..|:|.|.|||||||    |.||
Zfish   143 INC--GNITCAPLEFTCSSGRCVSRKFVCNGEDDCGDGSDEQDCAPSSC 189

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Culd	NP_729364.1	CUB	200..298	CDD:238001
Culd	NP_729364.1	LDLa	442..472	CDD:238060	15/39 (38%)
vldlr	XP_005155618.1	LDLa	29..63	CDD:238060
		LDLa	67..99	CDD:197566
		Ldl_recept_a	107..145	CDD:278486	0/1 (0%)
		Ldl_recept_a	149..184	CDD:278486	15/34 (44%)
		Ldl_recept_a	234..269	CDD:278486
		Ldl_recept_a	272..308	CDD:278486
		LDLa	316..346	CDD:238060
		FXa_inhibition	356..390	CDD:291342
		EGF_CA	392..426	CDD:214542
		NHL	479..>570	CDD:302697
		LY	504..541	CDD:214531
		NHL repeat	511..551	CDD:271320
		Ldl_recept_b	564..604	CDD:278487
		LY	588..630	CDD:214531
		Ldl_recept_b	651..690	CDD:278487
		FXa_inhibition	707..745	CDD:291342
		Mucin	<723..817	CDD:250634
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900