DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and ldlra

DIOPT Version :10

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001025454.1 Gene:ldlra / 387529 ZFINID:ZDB-GENE-031217-1 Length:911 Species:Danio rerio


Alignment Length:33 Identity:17/33 - (51%)
Similarity:22/33 - (66%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 EFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474
            ::.|||..||:.|..||..|.||||:|| |.:|
Zfish    28 QYQCGNGKCITARWVCDETDDCGDGTDELPAAC 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 15/29 (52%)
ldlraNP_001025454.1 LDLa 23..55 CDD:197566 13/26 (50%)
LDLa 65..101 CDD:238060
LDLa 106..140 CDD:238060
LDLa 144..176 CDD:197566
Ldl_recept_a 192..227 CDD:395011
Ldl_recept_a 231..266 CDD:395011
LDLa 274..304 CDD:238060
FXa_inhibition 314..348 CDD:464251
EGF_CA 350..380 CDD:214542
Ldl_recept_b 437..482 CDD:459654
Ldl_recept_b 485..525 CDD:459654
LY 510..551 CDD:214531
Ldl_recept_b 572..612 CDD:459654
FXa_inhibition 623..664 CDD:464251
PHA03247 <666..808 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.