DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and ldlra

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001025454.1 Gene:ldlra / 387529 ZFINID:ZDB-GENE-031217-1 Length:911 Species:Danio rerio


Alignment Length:33 Identity:17/33 - (51%)
Similarity:22/33 - (66%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 EFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474
            ::.|||..||:.|..||..|.||||:|| |.:|
Zfish    28 QYQCGNGKCITARWVCDETDDCGDGTDELPAAC 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 15/29 (52%)
ldlraNP_001025454.1 LDLa 23..55 CDD:197566 13/26 (50%)
Ldl_recept_a 63..101 CDD:365841
LDLa 106..140 CDD:238060
LDLa 144..176 CDD:197566
Ldl_recept_a 192..227 CDD:365841
Ldl_recept_a 231..266 CDD:365841
LDLa 274..304 CDD:238060
FXa_inhibition 314..348 CDD:373209
EGF_CA 350..380 CDD:214542
Ldl_recept_b 437..481 CDD:278487
Ldl_recept_b 485..525 CDD:278487
LY 510..551 CDD:214531
Ldl_recept_b 572..611 CDD:278487
FXa_inhibition 623..664 CDD:373209
PHA03247 <666..808 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.