DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and Vldlr

DIOPT Version :9

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_038731.2 Gene:Vldlr / 22359 MGIID:98935 Length:873 Species:Mus musculus


Alignment Length:34 Identity:17/34 - (50%)
Similarity:21/34 - (61%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 SEFLCGNNHCISIRLHCDGFDHCGDGSDE-PDSC 474
            |:|:|.|..|:..|..|||...|.||||| |:.|
Mouse    75 SDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQC 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 15/30 (50%)
VldlrNP_038731.2 LDLa 33..67 CDD:238060
LDLa 71..103 CDD:197566 13/27 (48%)
Ldl_recept_a 111..149 CDD:365841
Ldl_recept_a 153..188 CDD:365841
Ldl_recept_a 192..224 CDD:365841
Ldl_recept_a 237..273 CDD:365841
Ldl_recept_a 276..312 CDD:365841
Ldl_recept_a 320..350 CDD:365841
FXa_inhibition 360..394 CDD:373209
EGF_CA 396..426 CDD:214542
LDL-receptor class B 1 439..480
LY 461..499 CDD:214531
LDL-receptor class B 2 481..524
Ldl_recept_b 481..521 CDD:278487
LY 508..547 CDD:214531
LDL-receptor class B 3 525..567
LDL-receptor class B 4 568..611
Ldl_recept_b 568..608 CDD:278487
LY 592..634 CDD:214531
LDL-receptor class B 5 612..654
LDL-receptor class B 6 655..697
Ldl_recept_b 655..694 CDD:278487
FXa_inhibition 711..749 CDD:373209
Clustered O-linked oligosaccharides 751..790
Endocytosis signal. /evidence=ECO:0000255 832..837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.