powered by:
Protein Alignment Culd and egg-2
DIOPT Version :9
Sequence 1: | NP_729364.1 |
Gene: | Culd / 38946 |
FlyBaseID: | FBgn0035880 |
Length: | 965 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498537.1 |
Gene: | egg-2 / 187510 |
WormBaseID: | WBGene00019811 |
Length: | 548 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 17/43 - (39%) |
Similarity: | 21/43 - (48%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 444 FLC-GNNHCISIRLHCDGFDHCGDGSDEPD-SCEEDWAHLHHD 484
|.| .:..|:.....|:|...|.|||||.. ||:| ....|||
Worm 461 FKCSADKKCLPFHTRCNGVAECSDGSDEHKCSCQE-CLGTHHD 502
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.