DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Culd and F14B4.1

DIOPT Version :9

Sequence 1:	NP_729364.1	Gene:	Culd / 38946	FlyBaseID:	FBgn0035880	Length:	965	Species:	Drosophila melanogaster
Sequence 2:	NP_492474.2	Gene:	F14B4.1 / 172750	WormBaseID:	WBGene00008779	Length:	722	Species:	Caenorhabditis elegans

Alignment Length:	99	Identity:	26/99 - (26%)
Similarity:	35/99 - (35%)	Gaps:	25/99 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   437 NCYIGSEFLCG--NNHCISIRLHCDGFDHCGDGSDE----PDSCEEDWAHLHHDRRWYSHK---P 492
            || ..|:..||  :..|||....|||...|.:.:||    |..|.......|.     :||   |
Worm   621 NC-SESQIECGGADPKCISKIYLCDGLAQCSNQADEEKCPPRICLPGQFQCHD-----NHKCLPP 679

  Fly   493 NYYFPKIDQYPDLK----------TATGIFIIST 516
            .....|:....|..          |..|.|:::|
Worm   680 GGLCDKVTDCSDSSDEIYCEYQKTTEKGQFVLNT 713

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Culd	NP_729364.1	CUB	200..298	CDD:238001
Culd	NP_729364.1	LDLa	442..472	CDD:238060	12/35 (34%)
F14B4.1	NP_492474.2	vWFA	<272..313	CDD:294047
		LY	343..383	CDD:214531
		LY	391..425	CDD:214531
		Ldl_recept_b	448..486	CDD:278487
		LY	470..512	CDD:214531
		LY	513..549	CDD:214531
		FXa_inhibition	588..618	CDD:291342
		LDLa	622..658	CDD:238060	13/36 (36%)
		LDLa	663..698	CDD:238060	7/39 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900