DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Culd and F14B4.1

DIOPT Version :10

Sequence 1:NP_729364.1 Gene:Culd / 38946 FlyBaseID:FBgn0035880 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_492474.2 Gene:F14B4.1 / 172750 WormBaseID:WBGene00008779 Length:722 Species:Caenorhabditis elegans


Alignment Length:99 Identity:26/99 - (26%)
Similarity:35/99 - (35%) Gaps:25/99 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 NCYIGSEFLCG--NNHCISIRLHCDGFDHCGDGSDE----PDSCEEDWAHLHHDRRWYSHK---P 492
            || ..|:..||  :..|||....|||...|.:.:||    |..|.......|.     :||   |
 Worm   621 NC-SESQIECGGADPKCISKIYLCDGLAQCSNQADEEKCPPRICLPGQFQCHD-----NHKCLPP 679

  Fly   493 NYYFPKIDQYPDLK----------TATGIFIIST 516
            .....|:....|..          |..|.|:::|
 Worm   680 GGLCDKVTDCSDSSDEIYCEYQKTTEKGQFVLNT 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CuldNP_729364.1 CUB 200..298 CDD:238001
LDLa 442..472 CDD:238060 12/35 (34%)
F14B4.1NP_492474.2 vWFA <272..313 CDD:469594
LY 343..383 CDD:214531
LY 391..425 CDD:214531
Ldl_recept_b 448..487 CDD:459654
LY 470..512 CDD:214531
LY 513..549 CDD:214531
FXa_inhibition 588..618 CDD:464251
LDLa 622..658 CDD:238060 13/36 (36%)
LDLa 663..698 CDD:238060 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.