DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Culd and lrp4

DIOPT Version :9

Sequence 1:	NP_729364.1	Gene:	Culd / 38946	FlyBaseID:	FBgn0035880	Length:	965	Species:	Drosophila melanogaster
Sequence 2:	XP_017212642.2	Gene:	lrp4 / 110351181	ZFINID:	ZDB-GENE-130129-1	Length:	1913	Species:	Danio rerio

Alignment Length:	50	Identity:	21/50 - (42%)
Similarity:	22/50 - (44%)	Gaps:	14/50 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   443 EFLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAHLHHDRRWYSHKP 492
            ||.|....||....||||.|.|||.|||.| |.             ||:|
Zfish   197 EFQCAYGRCILDIYHCDGDDDCGDWSDESD-CS-------------SHQP 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Culd	NP_729364.1	CUB	200..298	CDD:238001
Culd	NP_729364.1	LDLa	442..472	CDD:238060	16/28 (57%)
lrp4	XP_017212642.2	LDLa	29..68	CDD:238060
		Ldl_recept_a	72..107	CDD:278486
		LDLa	111..143	CDD:197566
		LDLa	150..184	CDD:238060
		LDLa	233..267	CDD:238060	20/49 (41%)
		LDLa	272..306	CDD:238060
		LDLa	314..345	CDD:238060
		FXa_inhibition	360..395	CDD:317114
		EGF_CA	397..436	CDD:214542
		NHL	473..690	CDD:302697
		NHL repeat	473..511	CDD:271320
		LY	507..547	CDD:214531
		NHL repeat	515..551	CDD:271320
		NHL repeat	558..594	CDD:271320
		Ldl_recept_b	568..608	CDD:278487
		LY	592..634	CDD:214531
		NHL repeat	599..640	CDD:271320
		NHL repeat	644..681	CDD:271320
		FXa_inhibition	705..739	CDD:317114
		LY	<777..810	CDD:214531
		LY	813..855	CDD:214531
		Ldl_recept_b	876..916	CDD:278487
		LY	901..942	CDD:214531
		LY	943..984	CDD:214531
		FXa_inhibition	1011..1048	CDD:317114
		NHL	<1090..1282	CDD:302697
		NHL repeat	1090..1128	CDD:271320
		LY	1123..1163	CDD:214531
		NHL repeat	1133..1166	CDD:271320
		Ldl_recept_b	1184..1224	CDD:278487
		NHL repeat	1217..1249	CDD:271320
		NHL repeat	1258..1282	CDD:271320
		FXa_inhibition	1318..1353	CDD:317114
		LY	1389..1423	CDD:214531
		LY	1425..1467	CDD:214531
		Ldl_recept_b	1488..1528	CDD:278487
		LY	1512..1552	CDD:214531
		FXa_inhibition	1638..>1662	CDD:317114
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24270
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100