DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D5

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001127853.1 Gene:TBC1D5 / 9779 HGNCID:19166 Length:817 Species:Homo sapiens


Alignment Length:752 Identity:141/752 - (18%)
Similarity:224/752 - (29%) Gaps:291/752 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 LREWDSE------KRPKNLAPLVRLGVPEALRE---KIWQKLANVEGRMEMNDKYKILITKETKC 689
            ||.|.|.      ..|:.:.....|.:...|.:   .:|.|.        ..||         :.
Human   112 LRAWYSNIKEIHITNPRKVVGQQDLMINNPLSQDEGSLWNKF--------FQDK---------EL 159

  Fly   690 ETVIQRDIHRTFPAHKCFKE--IGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLL------ 746
            .::|::|:.||||..:.|::  :.....|.||    .||..:.::.|.||:..:.|.::      
Human   160 RSMIEQDVKRTFPEMQFFQQENVRKILTDVLF----CYARENEQLLYKQGMHELLAPIVFVLHCD 220

  Fly   747 ----LHMP------------------EEDAFCVLVALM------YDYGLRDLYKAGFEVLY---- 779
                ||..                  |.||:.|...||      :.....|..| |.|.|.    
Human   221 HQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLMETAEPWFSTFEHDGQK-GKETLMTPIP 284

  Fly   780 ----------LRLYQLERLIKDQLPKLHE-----HFTACGIETHMYASQWFLTLYTARFPLCFVF 829
                      :.:......|:|.|.|.|:     |.....|...:|..:|...|:...|||..:.
Human   285 FARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLL 349

  Fly   830 HVLDVFLLDGL----------PVLFQVAVTLLS----ICESDLRQLDFEG-----ILKYFRVTLP 875
            .|.|....|||          .:|..:...|:|    .|...|....|.|     |||...:..|
Human   350 VVWDALFADGLSLGLVDYIFVAMLLYIRDALISSNYQTCLGLLMHYPFIGDVHSLILKALFLRDP 414

  Fly   876 KKCRSSSQARKVMKQACERKIKKLKQYEEEFLLKKQHKERLEKEAQIYENRFGEERRKMQAEIDA 940
            |:     ..|.|..|                         .......|:.|          ..|.
Human   415 KR-----NPRPVTYQ-------------------------FHPNLDYYKAR----------GADL 439

  Fly   941 LNKQLTSAKERAVEKEKKHTGIIQEYKQII----------------------------------- 970
            :||..|:||...:...|....:|...:::|                                   
Human   440 MNKSRTNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAP 504

  Fly   971 -----QRQEQDMNTLSETL--------------GKVMHMVSNCQDCQ-------------QQIDA 1003
                 |:|:|.....||::              .:|...|....|.|             :.:..
Human   505 SHHLQQQQQQQRLMKSESMPVQLNKGDVVTGSDAQVSVPVQTLTDLQGLSSKNISSSPSVESLPG 569

  Fly  1004 G-------------NDNAKSDDGKNRGQTDAM-RNANEHPLGPLDPLNAASQRIRELELELAQAK 1054
            |             .|:..|:..::|..:..| |..:|..|              |.::...|.:
Human   570 GREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEEL--------------EAQISFLQGQ 620

  Fly  1055 LAQVEAECK--------------------NQDLNHQLSNTLSELQTNRNSWQPWLSKTFNSLQ-- 1097
            |..::|.||                    |.:...|:..:|:.|:..::..:.  |..||..|  
Human   621 LNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKG--SLRFNQSQLE 683

  Fly  1098 ----EKVTTRGGHR-DNGSGGPMPSFQSYMGQAPTTLSEASSPS------GNQEYKTFAFASV-- 1149
                |::|....|. .:|.|......||.  |....:.:|||.:      ||.:  .|...|.  
Human   684 AEENEQITIADNHYCSSGQGQGRGQGQSV--QMSGAIKQASSETPGCTDRGNSD--DFILISKDD 744

  Fly  1150 -GGSPKLPSKFQATKLRNSIDSLRNIVVPLDTGKTLA 1185
             |.|.:.....||..||    :||:     .:||:.|
Human   745 DGSSARGSFSGQAQPLR----TLRS-----TSGKSQA 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 57/279 (20%)
Phage_Gp23 <914..991 CDD:287621 17/130 (13%)
TBC1D5NP_001127853.1 TBC 79..381 CDD:214540 59/290 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.