DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and BUB2

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:69/286 - (24%)
Similarity:108/286 - (37%) Gaps:72/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 LLSGTGEVSKDCSQDTLD--EWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRM 673
            :||....:|:|..|....  .| .:|.:...|...:....|::||.|..   .|:||:.|     
Yeast    26 ILSEGLPISEDKQQQRTRCYVW-TVLSQTSMEASTQRYLALLKLGPPST---TIYQKIKN----- 81

  Fly   674 EMNDKYKILITKETKCETVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSE------- 731
                                  |..|||.....|:  ....:|||.:....:|....:       
Yeast    82 ----------------------DTSRTFQTDPNFR--NRVSEDALIRCLSCFAWQTQQRRQKTRF 122

  Fly   732 -----VGYCQGLSFIAASLLLHMPEED-AFCVLVALMYD----YGLRDLYKA--GFEVLYLRLYQ 784
                 ..|.||::.:.|.||...|.|. |:.:...|.|:    |..::|..|  |.::|.:.|  
Yeast   123 GRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKLLDISL-- 185

  Fly   785 LERLIKDQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDG--LPVLFQVA 847
              |:|.   |||.:..:...:...:|.....|||.:...||..|..:.|.....|  :.:||.||
Yeast   186 --RIID---PKLSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNILFVVA 245

  Fly   848 --VTLLS-ICESD-----LRQL-DFE 864
              |.:.| :.:||     |||. ||:
Yeast   246 FLVKMRSKVFKSDSPVNLLRQFPDFD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 55/236 (23%)
Phage_Gp23 <914..991 CDD:287621
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 69/286 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.