DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and GYP6

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_012491.3 Gene:GYP6 / 853406 SGDID:S000003580 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:68/360 - (18%)
Similarity:114/360 - (31%) Gaps:138/360 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 NDKYKILITKE------TKCET--VIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEV 732
            |||.|..::|.      |..||  :|..|:.|..             .|.:|:..|.:|      
Yeast   124 NDKTKGSLSKGSDEKPLTLRETLEIIDLDLSRIM-------------LDDIFQEPKVHA------ 169

  Fly   733 GYCQGLSFIAASLLLHMPEEDAFCVLVALMYDYGLRDLYKAGFEVLYLRLY-------------- 783
               |....:...||:|..|.        |.|..|..::    ..|:||:||              
Yeast   170 ---QMRQLLYNYLLIHQSEH--------LQYKQGFHEI----LSVIYLQLYHGTDLDNTDLQNVL 219

  Fly   784 --------QLERLIKDQ------------------LPKLHEHF------TACGIE---THMYAS- 812
                    |:|.:..::                  ||.|....      |..|.:   .|:..| 
Yeast   220 IIFNKLMNQIEPIFYNEENLINWDKRVFTKIFRICLPDLFSKVFYQPPKTGSGKKKNVDHLIHSN 284

  Fly   813 -----QWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICES---DLRQL-------- 861
                 :|...|:....||.:|..|.|..|....|:...:|.|::::..|   :|.:|        
Yeast   285 LIWLIRWTRLLFLRELPLKYVLIVWDHVLTFNYPLDIFIACTIITLLLSIYDELHELVSQGDYEH 349

  Fly   862 -----DFEGILKYFRVTLPKKCRSSSQAR-----KVMKQACERKIKKLKQYEE------------ 904
                 :|..::.:|:....|:..|....:     ||....||  :...|.|::            
Yeast   350 TNNNDEFVELILHFKKIFEKEDASKDDEKFLDLCKVTGNLCE--LWYGKNYDDMRLICDTFINAK 412

  Fly   905 ------EFLLKKQHKERLEKEAQIYENRFGEERRK 933
                  :.|..:..|..::...|..||:..|..|:
Yeast   413 FGIKTSDVLSMETAKLTIDPNRQSLENKLRERVRQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 49/247 (20%)
Phage_Gp23 <914..991 CDD:287621 5/20 (25%)
GYP6NP_012491.3 TBC <145..336 CDD:214540 42/224 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.