DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and AT3G02460

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_566172.1 Gene:AT3G02460 / 821261 AraportID:AT3G02460 Length:353 Species:Arabidopsis thaliana


Alignment Length:276 Identity:106/276 - (38%)
Similarity:158/276 - (57%) Gaps:19/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 SKDCSQDTLDEWDPILREWDS-------------EKRPKNLAPLVRLGVPEALREKIWQKLANVE 670
            ||..|....|..:..:|:|..             .::|..:...:|.|:|:.||..:||.::...
plant    41 SKTTSSTDHDREERKVRKWRKMIGVGGSDWKHYVRRKPNVVRRRIRKGIPDCLRGLVWQLISGSR 105

  Fly   671 GRMEMN-DKYKILITKETKC-ETVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVG 733
            ..:.|| ..|:.|:..||.. |..|.|||.||||:|..|::..|.||.:|:.|.|||:|:|.:||
plant   106 DLLLMNPGVYEQLVIYETSASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVLKAYSVYDRDVG 170

  Fly   734 YCQGLSFIAASLLLHMPEEDAFCVLVALM---YDYGLRDLYKAGFEVLYLRLYQLERLIKDQLPK 795
            |.||:.|||..|||:|.|||||.:||||:   ....:..||.||..::...|:|||.|:|:.:||
plant   171 YVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQQYLFQLESLVKELIPK 235

  Fly   796 LHEHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQ 860
            |.||||...|...|||||||:|:::..||......:.||||.:|:.::|:|.:.||..|:.:|.:
plant   236 LGEHFTQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVFKVGLALLKYCQDELVK 300

  Fly   861 LDFEGILKYFRVTLPK 876
            |.||.::...: |.|:
plant   301 LPFEKLIHALK-TFPE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 93/212 (44%)
Phage_Gp23 <914..991 CDD:287621
AT3G02460NP_566172.1 TBC 85..299 CDD:214540 93/213 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000497
OrthoInspector 1 1.000 - - mtm1084
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.