DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and GRTP1

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001273661.1 Gene:GRTP1 / 79774 HGNCID:20310 Length:344 Species:Homo sapiens


Alignment Length:281 Identity:81/281 - (28%)
Similarity:132/281 - (46%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 EWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMNDKYKILI---TKETKCE 690
            :|..:| :.....|.:.:...||.|||...|.::|..|:..:.:|:.|..|...:   .:..:.|
Human    45 KWSRLL-QGGGVPRSRTVKRYVRKGVPLEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLE 108

  Fly   691 TVIQRDIHRTFPAHKCF-KEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASL-LLHMPEED 753
            ..|:.|::||||.:..| |......|..|:.|..||..|:..||||||::|||..| |:...||:
Human   109 DAIRTDLNRTFPDNVKFRKTTDPCLQRTLYNVLLAYGHHNQGVGYCQGMNFIAGYLILITNNEEE 173

  Fly   754 AFCVLVALMYDYG--LRDLYKAGFEVLYLRLYQ--LERLIKDQLPKLHEHFTACGIETHMYASQW 814
            :|.:|.||:   |  |.|.|...  :|.|:..|  |..|::.:||.:.......|:...:..|:|
Human   174 SFWLLDALV---GRILPDYYSPA--MLGLKTDQEVLGELVRAKLPAVGALMERLGVLWTLLVSRW 233

  Fly   815 FLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGILKYFRVTLPKKCR 879
            |:.|:....|:..|..:.|....:|..::|:||:||:    ...::|..|.      .::|..|.
Human   234 FICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLI----KQHQELILEA------TSVPDICD 288

  Fly   880 SSSQARK---VMK-----QAC 892
            ...|..|   ||:     |.|
Human   289 KFKQITKGSFVMECHTFMQVC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 68/216 (31%)
Phage_Gp23 <914..991 CDD:287621
GRTP1NP_001273661.1 TBC 65..278 CDD:214540 69/221 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.