DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and EVI5

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_016857758.1 Gene:EVI5 / 7813 HGNCID:3501 Length:930 Species:Homo sapiens


Alignment Length:752 Identity:195/752 - (25%)
Similarity:321/752 - (42%) Gaps:205/752 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 PGGTGVATESDSNAQQSS-SW-----PYTIRAEWKAQEKAFEQLNLESSKTNLTVAVDIVMRRIQ 505
            |.|..|||:..:....|: ||     .:|:  ...|.:.|....:|.::.::.|           
Human    13 PSGKQVATDKVAEKLSSTLSWVKNTVSHTV--SQMASQVASPSTSLHTTSSSTT----------- 64

  Fly   506 EPVRFVIETPVTIQSASEMRIMDHFMSKRPMTLRFYLHLKRTEESNWKVNSIDPSEEITEQPGHQ 570
                  :.||....|:...      :|...:.|     |.:.||.|..:.:  .|:.:....|.:
Human    65 ------LSTPALSPSSPSQ------LSPDDLEL-----LAKLEEQNRLLET--DSKSLRSVNGSR 110

  Fly   571 QSSSLLKMGMNNLSRIVRSSSIASIEDDCPSDYSSDGDEPLLSGTGEVSKDCSQDTLDEWDPILR 635
            ::|     |.:.:|....||:::.:|                           :|:...|..|:.
Human   111 RNS-----GSSLVSSSSASSNLSHLE---------------------------EDSWILWGRIVN 143

  Fly   636 EWDS--EKRPKNLAP---------------------------LVRLGVPEALREKIWQKLANVEG 671
            ||:.  :|:.|.:.|                           ||..|:|...|..:||.|.:.:.
Human   144 EWEDVRKKKEKQVKPFECWVLYHHSQLCRFQVHYLKRSHTEELVHKGIPHHFRAIVWQLLCSAQS 208

  Fly   672 RMEMNDKYKILITKETKCETVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQ 736
             |.:.|:|..|:...:.||.:|:|||.||:|.|..|||....||:.||.|.|||::.|.||||||
Human   209 -MPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQ 272

  Fly   737 GLSFIAASLLLHMPEEDAFCVLVALMYDYGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFT 801
            |.:||...||:.||||:||||.|.||.||.||:|:|.....|.|.:||.|.:|::.||:|..||.
Human   273 GSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEHLPELFVHFQ 337

  Fly   802 ACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGI 866
            :....|.||||.||||::...|||.....:.|:|:.:||.::|:|.:.||.:.:::|.|||.||:
Human   338 SQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGM 402

  Fly   867 LKYFRVTLPKKCRSSSQARKVMKQACERKI--KKLKQYEEEFLLKKQHKERLEKEAQIYENRFGE 929
            |::|:..:|.  :......|:::.|.:.|.  ||:|:.|:|:...|..    |.|.|:...|...
Human   403 LQHFQKVIPH--QFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKTK----EMEEQVEIKRLRT 461

  Fly   930 ERRKMQAEIDALNKQLTSAKERAVE------KEKKHTGIIQEYKQIIQRQEQDMNTLSE----TL 984
            |.|.::..|:.|.|:..|..:|.::      :|.:...:|:.....|::|..:.:...|    |:
Human   462 ENRLLKQRIETLEKESASLADRLIQGQVTRAQEAEENYLIKRELATIKQQSDEASAKLEQAENTI 526

  Fly   985 GKVMHMVSNCQDCQQQIDAGNDNAKSDDGKNRGQTDAMRNANEHPLGPLDPLNAASQRIRELELE 1049
            .|:.|        |||....:.|...|                              .:.:||.|
Human   527 RKLQH--------QQQWHKCSSNYNED------------------------------FVLQLEKE 553

  Fly  1050 LAQAKLAQVEAECKNQDL----------NHQL--SNTLSELQTN--------------------- 1081
            |.||:|::.|::|..:::          |:.|  .|.::.||..                     
Human   554 LVQARLSEAESQCALKEMQDKVLDIEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQ 618

  Fly  1082 ----RNSWQPWLSKT------------FNSLQEKVTT 1102
                ...||..|::|            .|.||:::.|
Human   619 VKDLEEHWQRHLARTTGRWKDPPKKNAMNELQDELMT 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256 16/81 (20%)
TBC 650..858 CDD:214540 92/207 (44%)
Phage_Gp23 <914..991 CDD:287621 19/86 (22%)
EVI5XP_016857758.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D191811at2759
OrthoFinder 1 1.000 - - FOG0000497
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.