DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and Tbc1d5

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001272920.1 Gene:Tbc1d5 / 72238 MGIID:1919488 Length:837 Species:Mus musculus


Alignment Length:742 Identity:154/742 - (20%)
Similarity:243/742 - (32%) Gaps:247/742 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 SIASIEDDCPSDYSSDGDEPLLSGTGEVSKDCSQ---------DTLDEWDPILREWDSEKRPKN- 645
            |::.......|:....|.:||.|.:.:...|.||         ||...::..::||:......| 
Mouse     4 SVSETRHPLQSEEQEVGIDPLFSYSNKTRGDLSQNGRGSNSTLDTEGTFNSYMKEWEELFVNNNY 68

  Fly   646 LAPLVRLGVPEALREK-----IWQKLANV--EGRMEMNDKYK-----------ILITKETKC--- 689
            ||.:.:.|:...||..     .|:....|  :.:.:...|.|           |.||...|.   
Mouse    69 LATVRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISKIKELRAWYSSIKEIHITNPRKAAGQ 133

  Fly   690 --------------------------ETVIQRDIHRTFPAHKCFKE--IGGSGQDALFKVSKAYA 726
                                      .::|::|:.||||..:.|::  :.....|.||    .||
Mouse   134 QDLMINNPLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFFQQENVRKILTDVLF----CYA 194

  Fly   727 VHDSEVGYCQGLSFIAASLL----------LHMP------------------EEDAFCVLVALM- 762
            ..:.::.|.||:..:.|.::          ||..                  |.||:.:...|| 
Mouse   195 RENEQLLYKQGMHELLAPIIFTLHCDHQAFLHASESAQPSEEMKTLLNPEYLEHDAYAMFSQLME 259

  Fly   763 -----YDYGLRDLYKAGFEVL-----YLRLYQL---------ERLIKDQLPKLHE-----HFTAC 803
                 :.....|..| |.|.|     :.|...|         ...|:|.|.|.|:     |....
Mouse   260 TAEPWFSTFEHDGQK-GKETLMAPIPFARPQDLGPTVAIVTKVNQIQDHLLKKHDIELYMHLNRL 323

  Fly   804 GIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLD--FEGI 866
            .|...:|..:|...|:...|||..:..|.|....|.|                :|..:|  |..:
Mouse   324 EIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFADSL----------------NLSLVDYVFTAM 372

  Fly   867 LKYFRVTLPKKCRSSSQARKVMKQACERKIKKLKQYE-----EEFLLKK---QHKERLEKEA--Q 921
            |.|.|..|    .||:.      |.|   :..|..|.     ...:||.   :..:|..:.|  |
Mouse   373 LLYIRDAL----ISSNY------QTC---LGLLMHYPIIGDIHSLILKALFLRDPKRNPRPATYQ 424

  Fly   922 IYENRFGEERRKMQAEIDALNKQLTSAKERAVEKEKKHTGIIQEYKQIIQRQEQDMNTLSETLGK 986
            .:.|....:.|    ..|.:||..|:|:...:...|....:|...:::|        :.:...|.
Mouse   425 FHPNLDYYKAR----GADLMNKSRTNARGAPLNIHKVSNSLINFGRKLI--------SPASAPGS 477

  Fly   987 VMHMVSNCQDCQQQIDAGNDNAKSDDG--KNRGQTDAMRNANEHPLGPLDPLNAASQRIRELELE 1049
            :...|           .||:::.|...  ..|..|:|.|    |.|               |:.:
Mouse   478 MGGPV-----------PGNNSSSSFSAAIPTRTSTEAPR----HHL---------------LQQQ 512

  Fly  1050 LAQAKLAQVEAECKNQDLNHQLSNTLSELQTNRNSWQPWLSK----TFNSLQEKVTTRGGHRDNG 1110
            ..|....|.:.:.:.|...||.......|..: .|....|:|    |.:..|..|          
Mouse   513 QQQQHQQQQQQQPQQQQQQHQQQQQQQRLMKS-ESMPVQLNKGDVVTGSDAQVSV---------- 566

  Fly  1111 SGGPMPSFQSYMGQAPTTLSEASSPS-----GNQEYKTFAFASVGGSPKLPSKFQATKLRNSIDS 1170
               |:.:.....||:..|:|  ||||     |.:|:.        |||. ||   ||| ::|..|
Mouse   567 ---PVQALTDLQGQSSKTIS--SSPSIESLPGGREFT--------GSPP-PS---ATK-KDSFFS 613

  Fly  1171 LRNIVVPLDTGKTLA-----ENLKQQL 1192
              ||.......||:.     |.|:.|:
Mouse   614 --NIARSRSHSKTMGRKESEEELEAQI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 58/309 (19%)
Phage_Gp23 <914..991 CDD:287621 14/78 (18%)
Tbc1d5NP_001272920.1 TBC 79..381 CDD:214540 64/326 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.