DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and Grtp1

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:315 Identity:80/315 - (25%)
Similarity:141/315 - (44%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 EWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMNDKYKILITK---ETKCE 690
            :|..:|:.....::...:...||.|:|...|.::|..::..:.||:.:..|...:.:   .:..:
Mouse    50 KWSKLLKGNGGVRKSVTVKRYVRKGIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGESSSSLD 114

  Fly   691 TVIQRDIHRTFPAHKCFKEIGGSG-QDALFKVSKAYAVHDSEVGYCQ-----------------G 737
            ..|:.|::||||.:..|::..... |..|:.|..||.:|:.:|||||                 |
Mouse   115 EAIRTDLNRTFPDNVMFRKTADPCLQKTLYNVLLAYGLHNPDVGYCQCCAQKPGSSAGLRSSLTG 179

  Fly   738 LSFIAASL-LLHMPEEDAFCVLVALMYDYG--LRDLYKAGFEVLYLRLYQ--LERLIKDQLPKLH 797
            ::|||..| |:...||::|.:|.||:   |  |.|.|...  :|.|:..|  |..|::.:||.:.
Mouse   180 MNFIAGYLILITKNEEESFWLLDALV---GRILPDYYSPA--MLGLKTDQEVLAELVRMKLPAVA 239

  Fly   798 EHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLL----------- 851
            ......|:...:..|:||:.|:....|:..|..:.|....:|..::|:||:||:           
Mouse   240 ALMDGHGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEAS 304

  Fly   852 ---SICESDLRQL---DF--------------EGILKYFRVT-LPKKCRSSSQAR 885
               .||:. .:|:   ||              .|.|....:| |.|.||::.||:
Mouse   305 SIPDICDK-FKQITKGDFVTECHAFMQKIFSEPGSLSMTTITRLRKSCRAALQAQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 66/247 (27%)
Phage_Gp23 <914..991 CDD:287621
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 64/234 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.