DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and si:ch211-288d18.1

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_686696.2 Gene:si:ch211-288d18.1 / 558401 ZFINID:ZDB-GENE-060503-323 Length:603 Species:Danio rerio


Alignment Length:302 Identity:90/302 - (29%)
Similarity:147/302 - (48%) Gaps:27/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 ASIEDDCP---SDYS-----------SDGDEPLLSGTGEVSKDCSQDTLDEWDPILREWDSEKRP 643
            |.:|.| |   :|||           .:.:.|..|...|..|....:.:.:|..:|:.|...:..
Zfish    26 AGVEID-PWEDADYSIYRVTDRFGFLHEEELPTPSALEEKQKQVEIERVQKWLKMLKNWSKYRNS 89

  Fly   644 KNLAPLVRLGVPEALREKIWQKLANVE-------GRMEMNDKYKILITKETKCETVIQRDIHRTF 701
            ..:...|..|:|..||.:.|..|.:||       |:.|...:...|.:.|.|   .|..||:|||
Zfish    90 DRMMKRVFKGIPLQLRGQAWALLLDVEKVKSDNAGKYERMKEQAQLYSPEIK---QIDLDINRTF 151

  Fly   702 PAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLLLHMPEEDAFCVLVALMYD-- 764
            ..|..|.:..|..|.:||.|..||:|:::||.||||:|.|||.||:.|.|||||..|..|:.:  
Zfish   152 RNHIMFMDRFGVKQQSLFHVLSAYSVYNTEVSYCQGMSQIAAILLMFMNEEDAFWALSQLLTNQK 216

  Fly   765 YGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCFVF 829
            :|:...:..||..|.......::::...||||.:|.....:.:.:|:::|||..:..|.|.....
Zfish   217 HGMHGFFVPGFPKLQRFQNHHDQILSKLLPKLKKHLDKEQMSSGIYSTKWFLQCFINRTPFTLTL 281

  Fly   830 HVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGILKYFR 871
            .:.|:|:|:|..||..:|.|:|.:.:..|.::..|.:.::.:
Zfish   282 RLWDIFILEGEKVLTAMAYTILQLHKKRLLKMSLEELREFLQ 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 74/216 (34%)
Phage_Gp23 <914..991 CDD:287621
si:ch211-288d18.1XP_686696.2 TBC 98..311 CDD:214540 73/215 (34%)
DUF4688 <356..>444 CDD:292380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.