DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and CG5916

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:121/268 - (45%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 EWDPILRE-WDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMN-DKYKILITKE---TK 688
            :|:.||:: .|..:....|...:|.|:|...|..:|.|::........: |.::.|:..|   .:
  Fly    45 KWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKE 109

  Fly   689 CETVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLLLHM-PEE 752
            ....|..|:.||||.:..|    ...:..|:.:..|||.|:.:|||||||::||..||:.. .||
  Fly   110 ISDSISIDLPRTFPDNIHF----DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEE 170

  Fly   753 DAFCVL-------VALMYDYG----LRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACGIE 806
            .:|.:|       |...:.:.    ||||  |.|..|.:|          ::|.::.|....|:.
  Fly   171 KSFWLLKHIVENIVPQYHSHNMANLLRDL--AVFRELVIR----------RIPAVNRHVDNLGLP 223

  Fly   807 THMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLL-----SICESDLRQLDFEGI 866
            ..:.||:||:.::....|:..|..:.|....:|..::|:.|:|:.     :|...|    |...:
  Fly   224 YPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCD----DIAAL 284

  Fly   867 LKYFRVTL 874
            ...||.|:
  Fly   285 ANLFRDTM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 60/228 (26%)
Phage_Gp23 <914..991 CDD:287621
CG5916NP_001287357.1 TBC 67..276 CDD:214540 59/224 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.