DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and CG12241

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster


Alignment Length:625 Identity:130/625 - (20%)
Similarity:232/625 - (37%) Gaps:166/625 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 ITEQPGHQQSSSLLKMGMNNLSRIVRSSSIASIEDD-------CPSDYSSDGDEPLLSGTGEVSK 620
            :.|:.|.:|||:.|             .||..:||.       ...::|.             :|
  Fly    99 VEEEDGPEQSSNKL-------------LSIPFVEDAQQRLQWIAHLEFSH-------------NK 137

  Fly   621 DCSQDTLDEWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMND-KYKILIT 684
            :.::.:.:..|.:|      .|.:.|..:||.|:|..||.::|.:|:....:.:.:: .|..::.
  Fly   138 EAAELSWEHVDVML------PRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVK 196

  Fly   685 KETKCETV----IQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASL 745
            ..:..:.:    |::|:.|..|.:.||....|:|...|.::.:..|....::|||||...|.|.|
  Fly   197 ASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACL 261

  Fly   746 LLHMPEEDAFCVLVALMYDYGLRDLYKAGF---EVLYLRLYQ--LERLIKDQLPKLHEHFTACGI 805
            ||.|.||:||.::..:     :.||..|.:   .:|.::..|  :..||.:.|..:.|......|
  Fly   262 LLFMEEENAFWMMATI-----VEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDI 321

  Fly   806 ETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLD-----FEG 865
            |..:....|||||:.....:..:..:.|.|..:|..||||:.:.:|.:.|.||:.|:     |..
  Fly   322 ELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNS 386

  Fly   866 I------------------------------------LKYFRVTLPKKCRSSSQARKVMK-QACE 893
            :                                    |.|.......:..:...|..:.| |...
  Fly   387 LSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLAR 451

  Fly   894 RKIKKLKQYEEEFL----------LKKQHKERLE-----KEAQIYENR-FGEERRKMQAEIDALN 942
            |:::|.|...|.||          ||.::..:.|     :||.:...| |.....|:...|    
  Fly   452 RQVRKSKSILEAFLFRGDGNEGDQLKNKNIRQTEILVDLREAILKVGRHFITIEPKLAGHI---- 512

  Fly   943 KQLTSAKERAVEKEKKHTGII-------QEYKQIIQRQEQDMNTLSETLGKVMHMVSNCQD-C-- 997
             ||| |........|.|...|       :..|.:...:..|.:.|......::.::|...: |  
  Fly   513 -QLT-ANYSTESHAKDHENFINVARTRKRRAKALHDFERHDDDELGFRRNDIITIISQKDEHCWV 575

  Fly   998 -----------QQQIDAGNDNAK-----SDDGKNRGQTDAMRNA--------NEHPL-------G 1031
                       .:.::..::.:|     .||..:...||.:|..        .||.:       |
  Fly   576 GELNGLRGWFPAKFVELLDERSKLYTSAGDDAISETVTDLVRGTLAPAIKAFLEHGMKRPTFLGG 640

  Fly  1032 PLDP---LNAASQRIRELELELAQAKLAQVEAECKNQDLN 1068
            |:.|   :..|:.|..|.:.|...::|..    ||...|:
  Fly   641 PIHPWLYIEEAATREVEKDFESVYSRLVL----CKTYRLD 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 59/217 (27%)
Phage_Gp23 <914..991 CDD:287621 17/89 (19%)
CG12241NP_650432.1 TBC 161..375 CDD:214540 60/218 (28%)
SH3_SGSM3 540..592 CDD:212747 5/51 (10%)
RUN 619..773 CDD:280855 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.