DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and Tbc1d2

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_006538109.1 Gene:Tbc1d2 / 381605 MGIID:2652885 Length:923 Species:Mus musculus


Alignment Length:309 Identity:90/309 - (29%)
Similarity:144/309 - (46%) Gaps:27/309 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DEWDPILREWDSEKRPK-NLAPLVRLGVPEALREKIWQKLANVEGR-MEMNDKYKILITKETKCE 690
            |.|..:     :|..|. .|..|:|.|||...|.::|:.|.:...| ::....|:.|:.:...||
Mouse   599 DRWATL-----TELTPSAELKQLLRAGVPREHRPRVWRWLVHRRVRHLQAPGCYQELLARGRACE 658

  Fly   691 ----TVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAA-SLLLHMP 750
                ..|:.|::||||.:|.|.....|..|.|.:|..|::..:..:||||||:.:|| :||:...
Mouse   659 HPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLED 723

  Fly   751 EEDAFCVLVALMYDYGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACGIETHMYASQWF 815
            ||.||..|||::......:.|........:....|:.|:.::||:|..|.....::..:....||
Mouse   724 EESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQHRVDLSLITFNWF 788

  Fly   816 LTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQL-DFEGILKYFRVTLPKKCR 879
            |.::........:..|.|.||.:|..|:|:.|:.:....|..:.|| |...|.:|.|......|.
Mouse   789 LVVFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILQLQDSLEIYQYLRFFTKTICD 853

  Fly   880 SSSQARKVMKQACER----KIKKLKQYEEEFLLKKQHKERLEKEAQIYE 924
            |    ||:|..|...    .:|:|:|      |:..|:||||.|.:..|
Mouse   854 S----RKLMSIAFNDMNPFPMKQLRQ------LRAAHRERLEAELRELE 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 61/213 (29%)
Phage_Gp23 <914..991 CDD:287621 6/11 (55%)
Tbc1d2XP_006538109.1 PH_TBC1D2A 45..146 CDD:269966
PRK14951 <192..404 CDD:237865
COG4913 <300..>565 CDD:227250
TBC 620..832 CDD:214540 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.