DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D10C

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001356427.1 Gene:TBC1D10C / 374403 HGNCID:24702 Length:454 Species:Homo sapiens


Alignment Length:485 Identity:115/485 - (23%)
Similarity:180/485 - (37%) Gaps:122/485 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 EEITEQPGHQQSSSLLKMGMNNLSRIVRSSSIASIEDDCP----SDYSSDGDEPLLSGTGEVSKD 621
            |::.:.|..|..||.|             .|.:.:....|    ..|...|......|.|....|
Human     7 EDLVQPPELQDDSSSL-------------GSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPAD 58

  Fly   622 CSQDTLDEWDPILREWDS--EKRPKNLAPLVRLGVPEALREKIW-----------------QKLA 667
            ..:....:|..:...|:.  .:|.|.:....|.|:|.|||.:.|                 |:||
Human    59 LIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELA 123

  Fly   668 NVEGRMEMNDKYKILITKETKCETVIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEV 732
            ...|              :.:....|.||:||.||.|:.|....|.||..|.:|.|||.::..|.
Human   124 EAPG--------------DPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQ 174

  Fly   733 GYCQGLSFIAASLLLHMPEE--------DAFCVLVALMYDYGLRDLYKAGFEVLYLRLYQLERLI 789
            ||||....:||.||:|:|.|        :||..||.:...| |...|....|.:.|.......|:
Human   175 GYCQAQGPVAAVLLMHLPPEACALPLPQEAFWCLVQICEVY-LPGYYGPHMEAVRLDAEVFMALL 238

  Fly   790 KDQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSIC 854
            :..||.:|:|....|:...:|..:|||.|:....|...|..|.|.||.:|..|||:|.:||:.:.
Human   239 RRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLA 303

  Fly   855 ESDLRQLDFEGILKYFRVTLPKKCRSSSQARKVMKQACERKIKKL--------KQYEEEFLLKKQ 911
            .....|                            :.||...::.|        .|.:||..:.:.
Human   304 LGTAEQ----------------------------RGACPGLLETLGALRAIPPAQLQEEAFMSQV 340

  Fly   912 HKERL-EKEAQIYENRFGEERRKMQAEIDAL---------NKQLTSAKERAVEKEKKHTGIIQEY 966
            |...| |::.|          |:::|::..|         ..|:..|..:|:.:.::..|:.:..
Human   341 HSVVLSERDLQ----------REIKAQLAQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGA 395

  Fly   967 KQ-----IIQRQEQDM--NTLSETLGKVMH 989
            |.     ::|..|:..  ....:|.||..|
Human   396 KPEVPRIVVQPPEEPRPPRRKPQTRGKTFH 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 73/232 (31%)
Phage_Gp23 <914..991 CDD:287621 17/93 (18%)
TBC1D10CNP_001356427.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 12/63 (19%)
TBC 89..302 CDD:214540 73/227 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..454 7/34 (21%)
Interaction with calcineurin 414..454 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.