DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and RN-tre

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:620 Identity:152/620 - (24%)
Similarity:246/620 - (39%) Gaps:131/620 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 LKRTEESNWKV-----NSIDPSEEIT--EQPGHQQSSSLLKMGMNNLSRIVRSSSIASIEDDCPS 601
            :||.|:....:     ..:|||..:.  |.|..:......|.|..:.||:             ||
  Fly    11 VKRAEDEREDIFRRYELGLDPSNVVDSWENPTFEIYHRTDKYGFLHDSRL-------------PS 62

  Fly   602 DYSSDGDEPLLSGTGEVSKDCSQDTLDEWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKL 666
              :.|..| :.....|:.:|      .:|..:|.:|...:  ..|...|..|:|:.:|...|.||
  Fly    63 --TRDAQE-VHRNKIEMERD------KKWMKMLNQWPPPQ--DKLHKRVYKGIPDRVRMVAWNKL 116

  Fly   667 ANVEGRMEMNDKY---KILITKETKCET-VIQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAV 727
            .:::..:..|...   .:.:.::...|| .|..|::|.|..:..|:|.....|.:||.|..||::
  Fly   117 LDIQQSINNNAGVYLRMLQLARKYSTETRQIDADVNRQFRDNLAFRERYSVKQCSLFNVLNAYSI 181

  Fly   728 HDSEVGYCQGLSFIAASLLLHMPEEDAFCVLVALMYD--YGLRDLYKAGFEVLYLRLYQLERLIK 790
            ::||:|||||::.:|..|||::.||:||..|..|:.|  ||:..|:..||..|...:...:|::.
  Fly   182 YNSELGYCQGMACVAGVLLLYLHEEEAFWALNTLITDQKYGMHGLFIEGFPKLTRFIDHHDRIMS 246

  Fly   791 DQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICE 855
            ..:.|||:|||...::..:||.:||..::..|.|......|.|:|:|||..|:..:|:|:|.:.:
  Fly   247 KIMRKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLDGDRVILSMAITILYLHK 311

  Fly   856 SDLRQL-DFEGILKYFRVTLPKKCRSSSQARKVMKQACERKIKKLKQYEEEFLLKKQHKERLEKE 919
            .:|.:| |.:.|::|.:|.|.|....|...   ..||.||.:||||..            :|:..
  Fly   312 DELLRLKDMDAIIEYLQVRLHKNFGYSDDD---AIQALERVMKKLKDL------------KLDVP 361

  Fly   920 AQIYENRFGEERRKMQAEIDA-LNKQLTSAKERAVEKEKKHTGIIQEYKQIIQRQEQDMNTLSET 983
            .....|.|  ..||:...::| :.|::...:....:.||      |....:|.||||        
  Fly   362 PPAKSNEF--PTRKLGDFVEADMEKKIGRRRNDYTDAEK------QVITDVISRQEQ-------- 410

  Fly   984 LGKVMHMVSNCQDCQQQIDAGNDNAKSDDGKNRGQTDAMRNANEHPL-----------------G 1031
                     |..|.|..:........:.||.:....:::.:....|.                 .
  Fly   411 ---------NAIDVQSTVSYETSECATGDGYSMKTFESITSLATSPANSSYSLYSNGFVVTTIDS 466

  Fly  1032 PLDPLNAASQRIRELELELAQAKLAQVEAECKNQDLNH---------------QLSNTLSELQTN 1081
            ..||  |.||.|..|       ...|.........|.|               .|...|..||..
  Fly   467 EQDP--ARSQSIHNL-------SYLQTHPALPPNGLQHMRHSFSSDSDSRNRIDLDQALEVLQRQ 522

  Fly  1082 RNSWQPWLSKTFNSLQEKVTTRG--------GHRD 1108
            :....|   ||.:|....:...|        ||||
  Fly   523 QLPLHP---KTPSSQVVYIVQNGGGGGRYMDGHRD 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 69/213 (32%)
Phage_Gp23 <914..991 CDD:287621 15/77 (19%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 69/214 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.