DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D26

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001375394.1 Gene:TBC1D26 / 353149 HGNCID:28745 Length:468 Species:Homo sapiens


Alignment Length:489 Identity:112/489 - (22%)
Similarity:176/489 - (35%) Gaps:124/489 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DEWDPILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMN-DKYKILITKETKCET 691
            ::|..:|.:|...:..|.|:..|...:|.|:|.:.|..|.:::.....| .|||::..|..:...
Human    76 NKWQKMLADWTKYRSTKKLSQRVYKVIPLAVRGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSR 140

  Fly   692 V---IQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLLLHMPEED 753
            :   ||.|:..|...|..|.:..|..|..|..:..||:.::.||||.:.||.|.|.|||.:||||
Human   141 IIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYNPEVGYHRDLSRITAILLLCLPEED 205

  Fly   754 AFCVLVALMYDYGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACG--IETHMYASQWFL 816
            ||..|..|     |...|......|...|...|:::....||:..|....|  ||..|      |
Human   206 AFWALTQL-----LAVFYSPNTAWLERLLSHQEQVLHKSFPKIMRHLGKEGLCIEGSM------L 259

  Fly   817 TLYTARFPLCFV--------FHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGILKYFRVT 873
            |    |...||:        ..:.|||:|:|..||..:......|....|.:|.:..:.::    
Human   260 T----RLLRCFLDGKSFGLTLRLWDVFILEGARVLTAMVHASFKIHRKHLMKLSWSTVWEF---- 316

  Fly   874 LPKKCRSSSQARKVMKQACERKIKKLKQYEEEFLLKKQHKERLEKEAQIYENRFGEERRKMQAEI 938
                                                   :|||.:...:.:|..   .|.:|..:
Human   317 ---------------------------------------QERLSQSWALEDNAV---LRNLQTSM 339

  Fly   939 DALNKQLTSAKERAVEKEKKHTGIIQEYKQIIQRQEQDMNTLSETLGKVMHMVSNCQDCQQQIDA 1003
                |:||          |||..:......:   |.....|::..|               |..|
Human   340 ----KELT----------KKHWDLPPPGSLL---QNAHCYTIAWGL---------------QSKA 372

  Fly  1004 GNDNAKSDDGKNRGQTDAMRNANEHPLGPLDP-LNAASQRIRELELELAQAKLAQVEAEC----- 1062
            |.|:..|     |...|...:.::..|  |:| .:..:|:.|......|.....:::.||     
Human   373 GKDSCTS-----RASGDFHAHPSQKAL--LNPGCHLPAQKRRNEGQPAADQSQKEMKCECMAFLT 430

  Fly  1063 KNQDLNHQLSNTLSELQTNRN----SWQPWLSKT 1092
            ..|:..|:....|..|...|:    :..|||..|
Human   431 PRQNFGHKARLQLWPLTWTRDAPMQAGVPWLLLT 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 66/221 (30%)
Phage_Gp23 <914..991 CDD:287621 15/76 (20%)
TBC1D26NP_001375394.1 TBC 98..306 CDD:214540 66/222 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.