DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and GstT3

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:300 Identity:55/300 - (18%)
Similarity:98/300 - (32%) Gaps:109/300 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 LNLESSKTNLTVAVDIVMRRIQEPVRFVIETPVTIQSASEMRIMDHFMSK--RPMTLRFYLHLKR 546
            |.|.:.:..|.||.|.|::|     |.....|..::.::.:|.....||:  |.:.:.|.|....
  Fly    10 LGLSNDEDQLQVAFDEVLKR-----RVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMP 69

  Fly   547 TEESNWKVNSIDPSEEITEQPGHQQSSSLLKMGMNNLSRI--------VRSSSIASIEDDCPSDY 603
            .|:.   |.::...|.:||.         .|..:|...|:        ..:.|:|.:.       
  Fly    70 FEDC---VVALRNGEHLTED---------FKKEINRFQRVPCIHDNGYKLAESVAILR------- 115

  Fly   604 SSDGDEPLLSGTGEVSKD------CSQDTLDEWDPILREWDSEK---------RPKNLAPLVRLG 653
                   .||..|::.:.      ..|..:||:    .||....         |...|.||:...
  Fly   116 -------YLSAKGKIPEHLYPKYFVDQSRVDEF----LEWQHMSLRLTCAMYFRTVWLEPLLTGR 169

  Fly   654 VP-----EALR----------EKIWQKLANVEGR-------MEMNDKYKILITKETKCETVIQRD 696
            .|     |..|          |::|     :||:       :.:.|.:.....::|:   :...|
  Fly   170 TPSEAKIETFRMQMERNLDVVEEVW-----LEGKDFLTGSSLTVADIFAACEIEQTR---MADYD 226

  Fly   697 IHRTFP-------------------AHKCFKEIGGSGQDA 717
            :...:|                   ||:...:|.|:|..|
  Fly   227 VRIKYPKIRAWLKRVRQSCNPYYDVAHEFVYKISGTGPQA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256 10/38 (26%)
TBC 650..858 CDD:214540 16/108 (15%)
Phage_Gp23 <914..991 CDD:287621
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 18/101 (18%)
GstA 47..243 CDD:223698 38/233 (16%)
GST_C_Theta 135..259 CDD:198292 22/135 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.