DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and CG3703

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:293 Identity:52/293 - (17%)
Similarity:104/293 - (35%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   930 ERRKMQAEIDALNKQLTSAKERAVEKEKKHTGIIQEYKQIIQRQ-------EQDMNTLSETLGKV 987
            |.::.:.....:..||.:...|| |.|::...:.||.::::..:       ..|.|:.|..:   
  Fly     7 EAQETKDSCSTIEGQLPAGPVRA-EDEEEEVEVEQEQQELLSERWSPLGANYDDANSASSGV--- 67

  Fly   988 MHMVSNCQDCQQQIDAGNDNAKSDDGKNRGQTDAMRNANEHPLGPLDPLNAASQRIRELELELAQ 1052
                    ||  :::.|.:.:::..|....:...:|:..|........|.|.:.....::|.:.|
  Fly    68 --------DC--ELEPGLEKSEARRGSTGSELARLRSIEEEQELLTSSLLALTSHFAHVQLRVRQ 122

  Fly  1053 AKLAQVEAECKNQDLNHQLSNTLSELQTNRNSWQPWLSKTFNSLQEKVTTRGGHRDNGSG----- 1112
            .    |||..:.:|   ||...|.:.             .|..:.:.|.::..|.|..:.     
  Fly   123 I----VEAPAEERD---QLLRDLEDF-------------AFQGIPDAVQSKESHPDKPASDGEKD 167

  Fly  1113 -GPMPSFQSYMGQAPTTLSEASSPSGNQ---------EYKTFAFASVGG-------SPKLPSKFQ 1160
             ||.......:....|.|.:.:..:|..         |.:.|....:..       ..:||: ..
  Fly   168 HGPDSQLIQQLKSQLTELEQIAYEAGEPGILPQHVLLEKQKFILDELRAKLNLQVEQHELPA-LS 231

  Fly  1161 ATKLRNSID-SLRNIVVPLDTGKTLAENLKQQL 1192
            ..:||:.:| ::...|.||...:.|...||.|:
  Fly   232 TEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540
Phage_Gp23 <914..991 CDD:287621 12/67 (18%)
CG3703NP_569874.1 RUN 516..703 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.