DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D28

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_016879905.1 Gene:TBC1D28 / 254272 HGNCID:26858 Length:350 Species:Homo sapiens


Alignment Length:166 Identity:36/166 - (21%)
Similarity:64/166 - (38%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 GHQQSSSLLKMGMNNLSRIVRSSSIASIEDDCPSDYSSDGDEPLLSGTGEVSKDCSQDTLDEWDP 632
            ||:|..  ::...|||. ||....:                 |.:|......:.......::|..
Human    77 GHEQVD--VRKYTNNLG-IVHEMEL-----------------PRVSALEVKQRRKESKRTNKWQK 121

  Fly   633 ILREWDSEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMN-DKYKILITKETKCETV---I 693
            :|.:|...:..|.|:..|...:|.|:|.:....|.:::.....| .|||::..|..:...:   |
Human   122 MLADWTKYRSTKKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKYKVMKEKGKRSSRIIHCI 186

  Fly   694 QRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHD 729
            |.|:..|...|..|.:..|..|..|..:..||:.::
Human   187 QLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 21/84 (25%)
Phage_Gp23 <914..991 CDD:287621
TBC1D28XP_016879905.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.