DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D21

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_006720472.1 Gene:TBC1D21 / 161514 HGNCID:28536 Length:399 Species:Homo sapiens


Alignment Length:220 Identity:40/220 - (18%)
Similarity:89/220 - (40%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 RAEWKAQEKAFEQLN--LESSKTNLTVAVDIVMRRIQ-----EPVRFVIETPVTIQSASEMRIMD 528
            |..:||..:.:|::.  ||:...|.|...:.:.|.||     :|:..|:   :..:...::.::.
Human    91 RKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPLGNVL---IDKKRLEKILLLS 152

  Fly   529 HFMSKR--------PMTLRFYLHLKRTEESNWKVNSIDPSEEITEQPGHQQSSSLLKMGM-NNLS 584
            :..:.:        .|.:.|.|.::...|:.|..      :...::..|   |.::.:|: .||.
Human   153 YVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLF------QFFLQKTEH---SCVINIGVAKNLD 208

  Fly   585 RIVRSSSIASIEDDCPSDYSSDGDEPLLSGTGEVSK------DCSQDTLDEWDPILREWD---SE 640
            .:   |::.:..|...:::...      .|.|.|..      .|.|.....:|.:.|.|:   :.
Human   209 ML---STLITFLDPVFAEHLKG------KGAGAVQSLFPWFCFCFQRAFKSFDDVWRLWEVLLTG 264

  Fly   641 KRPKNLAPLVRLGVPEALREKIWQK 665
            |..:|...||...:.:.:||::.|:
Human   265 KPCRNFQVLVAYSMLQMVREQVLQE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256 13/58 (22%)
TBC 650..858 CDD:214540 4/16 (25%)
Phage_Gp23 <914..991 CDD:287621
TBC1D21XP_006720472.1 TBC 62..287 CDD:214540 39/216 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.