DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPcenA and TBC1D3D

DIOPT Version :9

Sequence 1:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster
Sequence 2:XP_006722311.1 Gene:TBC1D3D / 101060389 HGNCID:28944 Length:610 Species:Homo sapiens


Alignment Length:390 Identity:93/390 - (23%)
Similarity:155/390 - (39%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 NSID--------PSEEITEQPGHQQSSSLLKMGMNNLSRIVRSS-------SIASIEDDCPSD-- 602
            |::|        ||.|...|.|......:...|::......|:|       .:..::..|.|.  
Human    44 NNVDHLGIVQSCPSWESAPQEGPCPPFPVPSPGLSPELERDRASPFWGSAPRLGPLQAPCSSSAL 108

  Fly   603 ----YSSDGDEPLLSGTG-EVSKDCSQDTLDEWDPILREWDSEKRPKNLAPLVRLGVPEALREKI 662
                ||.....||.:... ::.::.|:.:  :|..:|.:|:..|..:.|......|:|..:|..:
Human   109 PGLPYSETELPPLTAREAKQIRREISRKS--KWVDMLGDWEKYKSSRKLIDRAYKGMPMNIRGPM 171

  Fly   663 WQKLANVEGRMEMND--KYKILITKETKCETVIQ---RDIHRTFPAHKCFKEIGGSGQDALFKVS 722
            |..|.|.| .|::.:  :|:|:..|..:....||   ||:..|...|..|::..|:.|..|..:.
Human   172 WSVLLNTE-EMKLKNPGRYQIMKEKGKRSSEHIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHIL 235

  Fly   723 KAYAVHDSEVGYCQGLSFIAASLLLHMPEEDAFCVLVALMYD----------------YGLRDLY 771
            .||..::.|||||:.||.|||..||::||||||..||.|:..                .||:|  
Human   236 LAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQD-- 298

  Fly   772 KAGFEVLYLRLYQLERLIKDQLPKLHEH---FTACGIETHMYASQWFLTLYTARFPLCFVFHVLD 833
                        |.|.::....||...|   ...||..:.:..   .:.:......|.....:.|
Human   299 ------------QQEHVVATSQPKTMGHQDKKDLCGQCSPLGC---LIRILIDGISLGLTLRLWD 348

  Fly   834 VFLLDG----LPV------LFQVAVTLLSICES---------DLRQLDFEGILKYFRVTLPKKCR 879
            |:|::|    :|:      :.|..:|..|.|..         |....|.:.:||:.|.::.|..|
Human   349 VYLVEGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKLTR 413

  Fly   880  879
            Human   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 64/250 (26%)
Phage_Gp23 <914..991 CDD:287621
TBC1D3DXP_006722311.1 TBC 160..373 CDD:214540 61/230 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.