DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and LHS1

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_012850.1 Gene:LHS1 / 853789 SGDID:S000001556 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:72/328 - (21%)
Similarity:147/328 - (44%) Gaps:38/328 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SIPSYYPASAYKLLADAAQ-TAGFHVAQIITEPTAAVLGYSIGEEQ---TEQRRHVL------TI 212
            :||.::.....|.|.||:. |.|.....:::|..:..:.:.:.:.|   .||:.:::      :|
Yeast   179 TIPDFFDQHQRKALLDASSITTGIEETYLVSEGMSVAVNFVLKQRQFPPGEQQHYIVYDMGSGSI 243

  Fly   213 KCGGLYSDIAFYSVQNGLFVQLATFGPFP-IGGRQFTEALVQFICEEFRRKYKL----DPHESRR 272
            | ..::|.:........:.::...:|..| :||.:||..:...|..:|...:..    :.|.:.:
Yeast   244 K-ASMFSILQPEDTTQPVTIEFEGYGYNPHLGGAKFTMDIGSLIENKFLETHPAIRTDELHANPK 307

  Fly   273 SVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQ 337
            ::|||..||...|.||:......:.|:||::.:|:...::|..||..|...:.::::.:.:.|  
Yeast   308 ALAKINQAAEKAKLILSANSEASINIESLINDIDFRTSITRQEFEEFIADSLLDIVKPINDAV-- 370

  Fly   338 AQKEHPG----LSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQAVCLI 398
             .|:..|    |.:|:.::|.|.:.:||.:|..:.....:.|:..:.:|||....|...:.:.|.
Yeast   371 -TKQFGGYGTNLPEINGVILAGGSSRIPIVQDQLIKLVSEEKVLRNVNADESAVNGVVMRGIKLS 434

  Fly   399 DPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLGRGSVLPAKIRI------SLPQS------E 451
            :..:.   |..:.|....:.:.:..::||....|..|||..|.|..|      |:|.:      |
Yeast   435 NSFKT---KPLNVVDRSVNTYSFKLSNESELYDVFTRGSAYPNKTSILTNTTDSIPNNFTIDLFE 496

  Fly   452 EGK 454
            .||
Yeast   497 NGK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 55/254 (22%)
LHS1NP_012850.1 HYOU1-like_NBD 23..430 CDD:212672 55/254 (22%)
Smc <581..737 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.