DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and SSC1

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_012579.1 Gene:SSC1 / 853503 SGDID:S000003806 Length:654 Species:Saccharomyces cerevisiae


Alignment Length:543 Identity:135/543 - (24%)
Similarity:232/543 - (42%) Gaps:117/543 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHVRADGKA-EVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVAH 69
            ||.:|.:...:|.:  :||. ::|.|.:|.|.:.:.:.:....|...|:.||::....|...:..
Yeast    34 GIDLGTTNSAVAIM--EGKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFA 96

  Fly    70 SFQLLQPKEELTEEKLSSALREIPCDFDKEELVFRMEHTVPSDREDQDDRVVT---KDLSAYQVT 131
            :.:|:..:.|  :.::...::::|....|               ....|..|.   :..|..|:.
Yeast    97 TKRLIGRRFE--DAEVQRDIKQVPYKIVK---------------HSNGDAWVEARGQTYSPAQIG 144

  Fly   132 VELLRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGY 196
            ..:|....|.|..|.  |:....||:::|:|:..|..:...||.|..|.:|.:::.|||||.|.|
Yeast   145 GFVLNKMKETAEAYL--GKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAY 207

  Fly   197 SIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQFTEALVQFICEEFRR 261
              |.|:::. :.|.....||...||:...:.||:|...:|.|...:||..|...|::.|...|:.
Yeast   208 --GLEKSDS-KVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKT 269

  Fly   262 KYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQL---YIDSLMDGVDY-NAQMSRARFESLIQP 322
            :..:|....|.::.:||.||...|..|::..||::   :|.:...|..: |.:.|||:||:|..|
Yeast   270 ETGIDLENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTAP 334

  Fly   323 VINNLIQQLGECVEQAQKEHPGL--SKIDDIVLLGATMQIPKLQAAVGARF---PDAKLHNSHSA 382
            ::...:..:.:.::.|     ||  |.|.:::|:|...::||:...|.:.|   |...:    :.
Yeast   335 LVKRTVDPVKKALKDA-----GLSTSDISEVLLVGGMSRMPKVVETVKSLFGKDPSKAV----NP 390

  Fly   383 DEVVAIGCARQA---------VCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESNAKLVLG---- 434
            ||.||||.|.|.         |.|:|.....|..|                       .||    
Yeast   391 DEAVAIGAAVQGAVLSGEVTDVLLLDVTPLSLGIE-----------------------TLGGVFT 432

  Fly   435 ----RGSVLPAKIRISLPQSEEGKGDDVSKAAA---SFKLRT--GESEI-----------LARLP 479
                |.:.:|.|           |....|.|||   |.::|.  ||.|:           ||.:|
Yeast   433 RLIPRNTTIPTK-----------KSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIP 486

  Fly   480 DSTIPEDGLYQLEVEVDVDDKDG 502
            .:  |: |:.|:||..|: |.||
Yeast   487 PA--PK-GVPQIEVTFDI-DADG 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 102/400 (26%)
SSC1NP_012579.1 dnaK 30..633 CDD:234715 135/543 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.