DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and Ankrd45

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_030099044.2 Gene:Ankrd45 / 73844 MGIID:1921094 Length:313 Species:Mus musculus


Alignment Length:200 Identity:44/200 - (22%)
Similarity:79/200 - (39%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LIQPVINNLIQQLGECVEQAQKEHP------GLSKIDDIV----LLGATM----QIPKLQAAVGA 369
            |:||.:...::.|.:..|  ..|||      .|...:|||    |..|.|    .:.|..|..|.
Mouse    99 LLQPTLTGDVEGLQKIFE--DPEHPHHEHAVQLLLEEDIVGRNLLYAACMAGKSDVIKALAKYGV 161

  Fly   370 RFPDAK------LHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWHGNDESN 428
            ...:|.      ||.:.:...:..:....:....|:.|..:..|..|.......:...:..|.::
Mouse   162 NLNEATARGYTLLHCAAAWGRLETLKALVELDVDIEALNFRGEKARDVAARYSQVECVNFLDWAD 226

  Fly   429 AKLVLGRGSVLPAKIRISLPQSEEGKG----DDVSKAAASFKLRTGESEILARLPDSTIPE--DG 487
            |:|:|.:   :..|..:.:...|:|.|    :|.|....:.:|:   :|.|...|:::|.|  :.
Mouse   227 ARLILKK---IITKSSLIITDPEKGPGKLFKEDKSTILNACRLK---NEWLESHPEASISEIFEQ 285

  Fly   488 LYQLE 492
            ..|||
Mouse   286 KQQLE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 21/94 (22%)
Ankrd45XP_030099044.2 Ank_2 123..200 CDD:403870 14/76 (18%)
ANK repeat 137..167 CDD:293786 6/29 (21%)
ANK repeat 169..200 CDD:293786 3/30 (10%)
PTZ00009 <246..300 CDD:240227 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.