DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7182 and HSPA13

DIOPT Version :9

Sequence 1:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_008879.3 Gene:HSPA13 / 6782 HGNCID:11375 Length:471 Species:Homo sapiens


Alignment Length:436 Identity:102/436 - (23%)
Similarity:184/436 - (42%) Gaps:73/436 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIKIGNSTLCIAHV--RADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAVA 68
            ||.:| :|.|...|  ...||.:||.::.| .:|...::....:::..|..:.:...:.|:..:.
Human    35 GIDLG-TTYCSVGVFFPGTGKVKVIPDENG-HISIPSMVSFTDNDVYVGYESVELADSNPQNTIY 97

  Fly    69 HSFQLLQPKEELTEEKLSSALREIPCD-FDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQVTV 132
            .:.:.:  .:..|.|:|.:.:...|.. .:|..:|   |.:|.|:.        |..:|...|..
Human    98 DAKRFI--GKIFTAEELEAEIGRYPFKVLNKNGMV---EFSVTSNE--------TITVSPEYVGS 149

  Fly   133 ELLRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYS 197
            .||....|:|..|.  |.....||:|:|:.:.........:||..||..:.::|.|||||.:.|.
Human   150 RLLLKLKEMAEAYL--GMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYG 212

  Fly   198 IGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQFTEALVQFICEEFRRK 262
            :.:...   .|||.|..||...|::..:.|.|:|:..|..|...:||:.|.:.|:|::.::..:.
Human   213 LHKADV---FHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQT 274

  Fly   263 YKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYI---------------------DSLMDGVD 306
            |...| ..:..:.::|.|....|..||...|.||.:                     |.|....|
Human   275 YGFVP-SRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADD 338

  Fly   307 ----------------------YNAQMSRARFESLIQPVINNLIQQLGECVEQAQKE-HPGLSKI 348
                                  :..::||..|::|.:    :|.|::...::|..|| |...::|
Human   339 HRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNE----DLFQKILVPIQQVLKEGHLEKTEI 399

  Fly   349 DDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQA 394
            |::||:|.:.:||:::..: ..|.....:.|...|..|..|.|.||
Human   400 DEVVLVGGSTRIPRIRQVI-QEFFGKDPNTSVDPDLAVVTGVAIQA 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 100/434 (23%)
HSPA13NP_008879.3 HSPA13-like_NBD 12..463 CDD:212679 102/436 (23%)
PRK13930 32..442 CDD:237564 99/432 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..352 3/36 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.